F225957

General Info

Members Datasets Scaffolds Average Seq Length
156 133 156 191

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0006581|Ga0500566_0006581_2814_3461
Length 215
Sequence MRLSACRFRRRSFVVILKAKLEKEGIMGRIVVTEFVSLDGVMEAPGGGEEYKHGGWTFEIDRGAEGDRFKLDELIEAEAQLLGRRTYEGFAAAWPGMTDDAGFAEKMNGMPKYVVSSTLESAEWNNSTVLSGDLVEEVTKLKQEVDGVILVAGSAQLVQGLLAHGLVDELRLMVFPVVLGSGKRLFGESEDKVALKLTDSKTVGDGIAILTYGRA

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 8.97
Rhizosphere 85.9
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1001468 3300000532 Bacteria 1977
2 JGI24740J21852_10016455 3300001979 Bacteria 2674
3 Ga0070683_100005399 3300005329 Bacteria 10668
4 Ga0068868_100004379 3300005338 Bacteria 9899
5 Ga0070691_10000006 3300005341 Bacteria 66177
6 Ga0070671_100379541 3300005355 Unclassified 1208
7 Ga0070688_100000326 3300005365 Bacteria 24367
8 Ga0070659_100026341 3300005366 Bacteria 4474
9 Ga0070667_100053878 3300005367 Bacteria 3395
10 Ga0070714_101485334 3300005435 Bacteria 662
11 Ga0070713_101676399 3300005436 Unclassified 617
12 Ga0070711_100010804 3300005439 Bacteria 5662
13 Ga0070681_10059193 3300005458 Bacteria 3810
14 Ga0070685_10000318 3300005466 Bacteria 29850
15 Ga0070698_100407082 3300005471 Bacteria 1294
16 Ga0070699_100045579 3300005518 Bacteria 3794
17 Ga0070679_100000537 3300005530 Bacteria 32232
18 Ga0070679_100975394 3300005530 Bacteria 791
19 Ga0070695_100390854 3300005545 Bacteria 1052
20 Ga0070704_100132945 3300005549 Unclassified 1931
21 Ga0068854_100000563 3300005578 Bacteria 22259
22 Ga0068856_100006486 3300005614 Bacteria 11473
23 Ga0068851_10001848 3300005834 Bacteria 9279
24 Ga0068863_100009669 3300005841 Bacteria 9409
25 Ga0068858_100000049 3300005842 Bacteria 122693
26 Ga0068860_101500333 3300005843 Bacteria 696
27 Ga0075432_10036800 3300006058 Bacteria 1702
28 Ga0075367_10254397 3300006178 Bacteria 1102
29 Ga0097621_100790300 3300006237 Bacteria 879
30 Ga0068871_100350882 3300006358 Bacteria 1305
31 Ga0075428_100089529 3300006844 Bacteria 3357
32 Ga0075428_100484858 3300006844 Bacteria 1323
33 Ga0075431_100043037 3300006847 Bacteria 4660
34 Ga0075431_100510551 3300006847 Bacteria 1192
35 Ga0075433_10005502 3300006852 Bacteria 9947
36 Ga0075433_10025959 3300006852 Bacteria 4955
37 Ga0075434_100106109 3300006871 Bacteria 2819
38 Ga0075429_100583919 3300006880 Bacteria 979
39 Ga0075435_100052195 3300007076 Bacteria 3295
40 Ga0105240_10085534 3300009093 Bacteria 3863
41 Ga0111539_10292522 3300009094 Bacteria 1895
42 Ga0105245_10000045 3300009098 Bacteria 134057
43 Ga0105245_10001251 3300009098 Bacteria 22959
44 Ga0105247_10000723 3300009101 Bacteria 25730
45 Ga0114129_10047458 3300009147 Bacteria 6033
46 Ga0114129_10160834 3300009147 Bacteria 3067
47 Ga0105241_10091268 3300009174 Bacteria 2403
48 Ga0105242_10000016 3300009176 Bacteria 124536
49 Ga0105242_10000200 3300009176 Bacteria 46508
50 Ga0105237_11425101 3300009545 Bacteria 699
51 Ga0105238_10000028 3300009551 Bacteria 188361
52 Ga0105239_10845021 3300010375 Bacteria 1050
53 Ga0157370_10093119 3300013104 Bacteria 2828
54 Ga0157369_10000037 3300013105 Bacteria 190395
55 Ga0157374_10012207 3300013296 Bacteria 7466
56 Ga0157378_10004112 3300013297 Bacteria 12845
57 Ga0157378_10053272 3300013297 Bacteria 3603
58 Ga0157372_10000064 3300013307 Bacteria 114648
59 Ga0157375_10000707 3300013308 Bacteria 29426
60 Ga0157375_10000945 3300013308 Bacteria 25164
61 Ga0157376_10030326 3300014969 Bacteria 4318
62 Ga0206349_1277073 3300020075 Bacteria 969
63 Ga0224712_10022644 3300022467 Unclassified 2169
64 Ga0207656_10002226 3300025321 Bacteria 6492
65 Ga0207710_10000296 3300025900 Bacteria 40066
66 Ga0207710_10016809 3300025900 Bacteria 3097
67 Ga0207710_10309429 3300025900 Bacteria 799
68 Ga0207685_10086701 3300025905 Bacteria 1308
69 Ga0207705_10485636 3300025909 Bacteria 959
70 Ga0207707_10036520 3300025912 Bacteria 4295
71 Ga0207695_10063514 3300025913 Bacteria 3806
72 Ga0207663_10007435 3300025916 Bacteria 5679
73 Ga0207660_10156301 3300025917 Bacteria 1756
74 Ga0207652_10000631 3300025921 Bacteria 34868
75 Ga0207694_10000008 3300025924 Bacteria 484902
76 Ga0207687_10000023 3300025927 Bacteria 217098
77 Ga0207687_10008626 3300025927 Bacteria 6666
78 Ga0207664_11143249 3300025929 Bacteria 695
79 Ga0207644_10235845 3300025931 Bacteria 1455
80 Ga0207690_10014600 3300025932 Bacteria 4744
81 Ga0207686_10000045 3300025934 Bacteria 119702
82 Ga0207686_10001015 3300025934 Bacteria 16623
83 Ga0207704_10000128 3300025938 Bacteria 41470
84 Ga0207661_10083365 3300025944 Bacteria 2645
85 Ga0207640_10000026 3300025981 Bacteria 142343
86 Ga0207658_10011128 3300025986 Bacteria 6127
87 Ga0207677_10002378 3300026023 Bacteria 9849
88 Ga0207703_10000053 3300026035 Bacteria 143924
89 Ga0207703_10000067 3300026035 Bacteria 125623
90 Ga0207702_10000134 3300026078 Bacteria 88324
91 Ga0207702_10050223 3300026078 Bacteria 3521
92 Ga0207641_10005897 3300026088 Bacteria 10393
93 Ga0207428_10405979 3300027907 Bacteria 997
94 Ga0268266_10000023 3300028379 Bacteria 501899
95 Ga0265334_10043741 3300028573 Bacteria 1742
96 Ga0307511_10062459 3300030521 Bacteria 2827
97 Ga0395900_0237321 3300037418 Bacteria 1830
98 Ga0395901_0273711 3300038443 Bacteria 1756
99 Ga0395901_0734273 3300038443 Bacteria 982
100 Ga0436363_0262548 3300039450 Bacteria 1708
101 Ga0451802_0839983 3300041460 Bacteria 779
102 Ga0451833_1341918 3300041491 Bacteria 1190
103 Ga0466963_0000070 3300044694 Bacteria 35676
104 Ga0466957_0047139 3300044842 Unclassified 2618
105 Ga0466960_0083548 3300044901 Bacteria 1614
106 Ga0466959_0785572 3300045049 Bacteria 637
107 Ga0466967_0051331 3300045976 Bacteria 3614
108 Ga0495603_0245806 3300046455 Bacteria 1030
109 Ga0495629_0151779 3300046459 Bacteria 1610
110 Ga0495641_0117249 3300046461 Bacteria 1187
111 Ga0495651_0042223 3300046462 Bacteria 3542
112 Ga0495653_0065764 3300046463 Bacteria 2728
113 Ga0495582_0119276 3300046473 Bacteria 1486
114 Ga0495664_0310341 3300046477 Bacteria 952
115 Ga0495628_0000649 3300046516 Bacteria 31834
116 Ga0495640_0020312 3300046533 Bacteria 4891
117 Ga0495587_0118850 3300046536 Bacteria 1514
118 Ga0495669_0300095 3300046684 Bacteria 774
119 Ga0495624_0000028 3300046690 Bacteria 93474
120 Ga0495649_0019836 3300046694 Bacteria 3775
121 Ga0495674_0000025 3300047319 Bacteria 141103
122 Ga0495676_0479969 3300047321 Bacteria 818
123 Ga0495680_0000421 3300047322 Bacteria 47432
124 Ga0495680_0228376 3300047322 Bacteria 1326
125 Ga0495675_0038796 3300047444 Bacteria 3033
126 Ga0495686_0022256 3300047472 Bacteria 4195
127 Ga0495602_0117642 3300048088 Bacteria 2145
128 Ga0496102_0000093 3300048905 Bacteria 125578
129 Ga0496103_0000001 3300048906 Bacteria 643471
130 Ga0496104_0000007 3300048907 Bacteria 524804
131 Ga0496105_0000002 3300048908 Bacteria 753215
132 Ga0496110_0000008 3300048913 Bacteria 113408
133 Ga0496111_0000004 3300048914 Bacteria 116115
134 Ga0496112_0051805 3300048915 Bacteria 4027
135 Ga0496112_0372652 3300048915 Bacteria 1369
136 Ga0496113_0000003 3300048916 Bacteria 123519
137 Ga0496114_0000010 3300048917 Bacteria 363396
138 Ga0496115_0000022 3300048918 Bacteria 164224
139 Ga0496115_0000088 3300048918 Bacteria 86213
140 Ga0496115_0312749 3300048918 Bacteria 1286
141 Ga0496117_0200987 3300048920 Bacteria 1126
142 Ga0496119_0002585 3300048922 Bacteria 19677
143 Ga0496120_0068011 3300048923 Bacteria 1966
144 Ga0501070_0088747 3300049586 Bacteria 2559
145 nmdc:mga05p37_130640_c1 3300050507 Bacteria 3081
146 nmdc:mga0qj67_450796_c1 3300050509 Bacteria 1036
147 nmdc:mga06r32_410817_c1 3300050510 Bacteria 1335
148 nmdc:mga06r32_60757_c1 3300050510 Bacteria 3637
149 nmdc:mga08y16_244518_c1 3300050511 Bacteria 1854
150 nmdc:mga0rr50_418297_c1 3300050513 Bacteria 1134
151 nmdc:mga08x19_134848_c1 3300050514 Bacteria 1664
152 nmdc:mga0a205_922_c2 3300050515 Bacteria 12948
153 Ga0495619_0000020 3300053085 Bacteria 201556
154 Ga0495619_0001484 3300053085 Bacteria 15467
155 Ga0495619_0090553 3300053085 Bacteria 2071
156 Ga0500566_0006581 3300053094 Bacteria 6888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_101676399 Ga0070713_1016763991 180
2 3300006058 Ga0075432_10036800 Ga0075432_100368001 181
3 3300006178 Ga0075367_10254397 Ga0075367_102543972 181
4 3300006844 Ga0075428_100484858 Ga0075428_1004848582 181
5 3300006847 Ga0075431_100510551 Ga0075431_1005105512 181
6 3300006852 Ga0075433_10025959 Ga0075433_100259592 181
7 3300006871 Ga0075434_100106109 Ga0075434_1001061094 181
8 3300007076 Ga0075435_100052195 Ga0075435_1000521953 181
9 3300027907 Ga0207428_10405979 Ga0207428_104059791 181
10 3300039450 Ga0436363_0262548 Ga0436363_0262548_390_947 183
11 3300047444 Ga0495675_0038796 Ga0495675_0038796_1946_2497 183
12 3300005518 Ga0070699_100045579 Ga0070699_1000455795 185
13 3300038443 Ga0395901_0734273 Ga0395901_0734273_285_905 185
14 3300009147 Ga0114129_10047458 Ga0114129_100474585 186
15 3300038443 Ga0395901_0273711 Ga0395901_0273711_96_665 186
16 3300044901 Ga0466960_0083548 Ga0466960_0083548_598_1158 186
17 3300045976 Ga0466967_0051331 Ga0466967_0051331_2067_2657 186
18 3300050510 nmdc:mga06r32_410817_c1 nmdc:mga06r32_410817_c1_678_1238 186
19 3300050513 nmdc:mga0rr50_418297_c1 nmdc:mga0rr50_418297_c1_184_744 186
20 3300050514 nmdc:mga08x19_134848_c1 nmdc:mga08x19_134848_c1_597_1157 186
21 3300001979 JGI24740J21852_10016455 JGI24740J21852_100164554 187
22 3300005435 Ga0070714_101485334 Ga0070714_1014853341 187
23 3300005471 Ga0070698_100407082 Ga0070698_1004070822 187
24 3300005843 Ga0068860_101500333 Ga0068860_1015003331 187
25 3300009101 Ga0105247_10000723 Ga0105247_1000072310 187
26 3300009176 Ga0105242_10000200 Ga0105242_1000020017 187
27 3300013297 Ga0157378_10053272 Ga0157378_100532724 187
28 3300025900 Ga0207710_10000296 Ga0207710_1000029611 187
29 3300025929 Ga0207664_11143249 Ga0207664_111432491 187
30 3300025934 Ga0207686_10001015 Ga0207686_100010152 187
31 3300045049 Ga0466959_0785572 Ga0466959_0785572_42_614 187
32 3300047321 Ga0495676_0479969 Ga0495676_0479969_92_661 187
33 3300048907 Ga0496104_0000007 Ga0496104_0000007_522287_522931 187
34 3300048908 Ga0496105_0000002 Ga0496105_0000002_725226_725870 187
35 3300048922 Ga0496119_0002585 Ga0496119_0002585_928_1572 187
36 3300048923 Ga0496120_0068011 Ga0496120_0068011_309_953 187
37 3300005439 Ga0070711_100010804 Ga0070711_1000108044 188
38 3300005530 Ga0070679_100975394 Ga0070679_1009753942 188
39 3300020075 Ga0206349_1277073 Ga0206349_12770732 188
40 3300022467 Ga0224712_10022644 Ga0224712_100226442 188
41 3300025900 Ga0207710_10016809 Ga0207710_100168094 188
42 3300025909 Ga0207705_10485636 Ga0207705_104856361 188
43 3300025916 Ga0207663_10007435 Ga0207663_100074356 188
44 3300037418 Ga0395900_0237321 Ga0395900_0237321_13_783 188
45 3300041491 Ga0451833_1341918 Ga0451833_1341918_26_592 188
46 3300053085 Ga0495619_0001484 Ga0495619_0001484_6944_7513 188
47 3300000532 CNAas_1001468 CNAas_10014682 189
48 3300005329 Ga0070683_100005399 Ga0070683_10000539910 189
49 3300005338 Ga0068868_100004379 Ga0068868_1000043796 189
50 3300005341 Ga0070691_10000006 Ga0070691_1000000641 189
51 3300005355 Ga0070671_100379541 Ga0070671_1003795412 189
52 3300005365 Ga0070688_100000326 Ga0070688_10000032612 189
53 3300005366 Ga0070659_100026341 Ga0070659_1000263414 189
54 3300005367 Ga0070667_100053878 Ga0070667_1000538782 189
55 3300005458 Ga0070681_10059193 Ga0070681_100591934 189
56 3300005466 Ga0070685_10000318 Ga0070685_1000031820 189
57 3300005530 Ga0070679_100000537 Ga0070679_10000053727 189
58 3300005545 Ga0070695_100390854 Ga0070695_1003908542 189
59 3300005549 Ga0070704_100132945 Ga0070704_1001329453 189
60 3300005578 Ga0068854_100000563 Ga0068854_10000056314 189
61 3300005614 Ga0068856_100006486 Ga0068856_1000064868 189
62 3300005834 Ga0068851_10001848 Ga0068851_100018484 189
63 3300005841 Ga0068863_100009669 Ga0068863_1000096695 189
64 3300005842 Ga0068858_100000049 Ga0068858_10000004932 189
65 3300006237 Ga0097621_100790300 Ga0097621_1007903001 189
66 3300006358 Ga0068871_100350882 Ga0068871_1003508822 189
67 3300006844 Ga0075428_100089529 Ga0075428_1000895293 189
68 3300006847 Ga0075431_100043037 Ga0075431_1000430374 189
69 3300006852 Ga0075433_10005502 Ga0075433_100055027 189
70 3300006880 Ga0075429_100583919 Ga0075429_1005839192 189
71 3300009093 Ga0105240_10085534 Ga0105240_100855344 189
72 3300009094 Ga0111539_10292522 Ga0111539_102925222 189
73 3300009098 Ga0105245_10000045 Ga0105245_10000045100 189
74 3300009098 Ga0105245_10001251 Ga0105245_100012514 189
75 3300009147 Ga0114129_10160834 Ga0114129_101608342 189
76 3300009174 Ga0105241_10091268 Ga0105241_100912682 189
77 3300009176 Ga0105242_10000016 Ga0105242_1000001611 189
78 3300009545 Ga0105237_11425101 Ga0105237_114251011 189
79 3300009551 Ga0105238_10000028 Ga0105238_10000028160 189
80 3300010375 Ga0105239_10845021 Ga0105239_108450212 189
81 3300013104 Ga0157370_10093119 Ga0157370_100931192 189
82 3300013105 Ga0157369_10000037 Ga0157369_10000037117 189
83 3300013296 Ga0157374_10012207 Ga0157374_100122079 189
84 3300013297 Ga0157378_10004112 Ga0157378_1000411213 189
85 3300013307 Ga0157372_10000064 Ga0157372_1000006490 189
86 3300013308 Ga0157375_10000707 Ga0157375_1000070728 189
87 3300013308 Ga0157375_10000945 Ga0157375_100009458 189
88 3300014969 Ga0157376_10030326 Ga0157376_100303264 189
89 3300025321 Ga0207656_10002226 Ga0207656_100022265 189
90 3300025900 Ga0207710_10309429 Ga0207710_103094292 189
91 3300025905 Ga0207685_10086701 Ga0207685_100867012 189
92 3300025912 Ga0207707_10036520 Ga0207707_100365205 189
93 3300025913 Ga0207695_10063514 Ga0207695_100635144 189
94 3300025917 Ga0207660_10156301 Ga0207660_101563013 189
95 3300025921 Ga0207652_10000631 Ga0207652_1000063129 189
96 3300025924 Ga0207694_10000008 Ga0207694_10000008447 189
97 3300025927 Ga0207687_10000023 Ga0207687_10000023100 189
98 3300025927 Ga0207687_10008626 Ga0207687_100086262 189
99 3300025931 Ga0207644_10235845 Ga0207644_102358452 189
100 3300025932 Ga0207690_10014600 Ga0207690_100146004 189
101 3300025934 Ga0207686_10000045 Ga0207686_1000004511 189
102 3300025938 Ga0207704_10000128 Ga0207704_100001283 189
103 3300025944 Ga0207661_10083365 Ga0207661_100833652 189
104 3300025981 Ga0207640_10000026 Ga0207640_10000026128 189
105 3300025986 Ga0207658_10011128 Ga0207658_100111284 189
106 3300026023 Ga0207677_10002378 Ga0207677_100023786 189
107 3300026035 Ga0207703_10000053 Ga0207703_1000005334 189
108 3300026035 Ga0207703_10000067 Ga0207703_100000672 189
109 3300026078 Ga0207702_10000134 Ga0207702_100001346 189
110 3300026078 Ga0207702_10050223 Ga0207702_100502232 189
111 3300026088 Ga0207641_10005897 Ga0207641_100058976 189
112 3300028379 Ga0268266_10000023 Ga0268266_10000023331 189
113 3300028573 Ga0265334_10043741 Ga0265334_100437411 189
114 3300030521 Ga0307511_10062459 Ga0307511_100624594 189
115 3300041460 Ga0451802_0839983 Ga0451802_0839983_190_759 189
116 3300044694 Ga0466963_0000070 Ga0466963_0000070_19626_20195 189
117 3300044842 Ga0466957_0047139 Ga0466957_0047139_385_954 189
118 3300046455 Ga0495603_0245806 Ga0495603_0245806_88_660 189
119 3300046459 Ga0495629_0151779 Ga0495629_0151779_787_1362 189
120 3300046461 Ga0495641_0117249 Ga0495641_0117249_50_622 189
121 3300046462 Ga0495651_0042223 Ga0495651_0042223_1536_2165 189
122 3300046463 Ga0495653_0065764 Ga0495653_0065764_1526_2155 189
123 3300046473 Ga0495582_0119276 Ga0495582_0119276_274_846 189
124 3300046477 Ga0495664_0310341 Ga0495664_0310341_95_664 189
125 3300046516 Ga0495628_0000649 Ga0495628_0000649_14690_15259 189
126 3300046533 Ga0495640_0020312 Ga0495640_0020312_2264_2836 189
127 3300046536 Ga0495587_0118850 Ga0495587_0118850_340_909 189
128 3300046684 Ga0495669_0300095 Ga0495669_0300095_62_631 189
129 3300046690 Ga0495624_0000028 Ga0495624_0000028_37551_38126 189
130 3300046694 Ga0495649_0019836 Ga0495649_0019836_2599_3174 189
131 3300047319 Ga0495674_0000025 Ga0495674_0000025_68447_69019 189
132 3300047322 Ga0495680_0000421 Ga0495680_0000421_35380_35955 189
133 3300047322 Ga0495680_0228376 Ga0495680_0228376_17_586 189
134 3300047472 Ga0495686_0022256 Ga0495686_0022256_73_642 189
135 3300048088 Ga0495602_0117642 Ga0495602_0117642_1354_1926 189
136 3300048905 Ga0496102_0000093 Ga0496102_0000093_12756_13325 189
137 3300048906 Ga0496103_0000001 Ga0496103_0000001_12756_13325 189
138 3300048913 Ga0496110_0000008 Ga0496110_0000008_39309_39878 189
139 3300048914 Ga0496111_0000004 Ga0496111_0000004_111549_112118 189
140 3300048915 Ga0496112_0051805 Ga0496112_0051805_1425_1994 189
141 3300048915 Ga0496112_0372652 Ga0496112_0372652_65_637 189
142 3300048916 Ga0496113_0000003 Ga0496113_0000003_39986_40555 189
143 3300048917 Ga0496114_0000010 Ga0496114_0000010_96048_96617 189
144 3300048918 Ga0496115_0000022 Ga0496115_0000022_103644_104222 189
145 3300048918 Ga0496115_0000088 Ga0496115_0000088_24896_25465 189
146 3300048918 Ga0496115_0312749 Ga0496115_0312749_670_1239 189
147 3300048920 Ga0496117_0200987 Ga0496117_0200987_128_697 189
148 3300049586 Ga0501070_0088747 Ga0501070_0088747_1804_2379 189
149 3300050507 nmdc:mga05p37_130640_c1 nmdc:mga05p37_130640_c1_1549_2133 189
150 3300050509 nmdc:mga0qj67_450796_c1 nmdc:mga0qj67_450796_c1_227_811 189
151 3300050510 nmdc:mga06r32_60757_c1 nmdc:mga06r32_60757_c1_1198_1782 189
152 3300050511 nmdc:mga08y16_244518_c1 nmdc:mga08y16_244518_c1_775_1359 189
153 3300050515 nmdc:mga0a205_922_c2 nmdc:mga0a205_922_c2_4672_5244 189
154 3300053085 Ga0495619_0000020 Ga0495619_0000020_83495_84064 189
155 3300053085 Ga0495619_0090553 Ga0495619_0090553_481_1050 189
156 3300053094 Ga0500566_0006581 Ga0500566_0006581_2814_3461 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

29

209

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.834 3 189
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8335 1 189
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8312 1 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8284 1 189
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8247 1 189
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8335 1 189 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8205 1 189 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8198 3 187 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.811 3 187 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8053 3 189 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9825 34 189 GO:0008703
GO:0009231
AF-A0A536N3B8-F1-model_v4 Dihydrofolate reductase 0.9706 1 162 GO:0008703
GO:0009231
AF-A0A2W6DLZ4-F1-model_v4 Pyrimidine reductase 0.9646 1 189 GO:0008703
GO:0009231
AF-A0A537YCT7-F1-model_v4 Dihydrofolate reductase 0.9635 1 189 GO:0008703
GO:0009231
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9618 51 189 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
89.96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map