F225837

General Info

Members Datasets Scaffolds Average Seq Length
156 127 312 141

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0413718|Ga0501041_0413718_215_730
Length 171
Sequence LRAAAGTRHAPHRRACAQARGTPNSRGAITMKRTASAVWNGDLKTGKGTVSTQSGVLNGTQYSFGTRFESGTGTNPEELIAAAHAGCFTMALSAQLGTANLVPQQLETQATLTFDKTDAGWTVTGIHLAVVGRVPGADDATFQKLASGAKSDCPISRLLKTTITMEAKLQA

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
70 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
77 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 3.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 1.28
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0413718 3300049577 Bacteria 855
2 rootH2_10192669 3300003320 Bacteria 1479
3 Ga0065707_10165791 3300005295 Bacteria 1524
4 Ga0070658_10007773 3300005327 Bacteria 8641
5 Ga0068869_100786194 3300005334 Bacteria 817
6 Ga0070689_100954421 3300005340 Bacteria 761
7 Ga0070692_10646874 3300005345 Bacteria 705
8 Ga0070669_100925779 3300005353 Bacteria 745
9 Ga0070703_10409504 3300005406 Bacteria 592
10 Ga0070714_100097746 3300005435 Bacteria 2582
11 Ga0070710_10181737 3300005437 Bacteria 1317
12 Ga0070711_100716742 3300005439 Bacteria 843
13 Ga0070708_100020232 3300005445 Bacteria 5609
14 Ga0070708_100114556 3300005445 Bacteria 2481
15 Ga0070681_10234945 3300005458 Bacteria 1747
16 Ga0070698_100009562 3300005471 Bacteria 10377
17 Ga0070698_101404730 3300005471 Bacteria 649
18 Ga0070679_101357617 3300005530 Bacteria 657
19 Ga0070695_100001370 3300005545 Bacteria 13524
20 Ga0070693_100726839 3300005547 Bacteria 729
21 Ga0070665_100420058 3300005548 Bacteria 1346
22 Ga0070704_100109610 3300005549 Bacteria 2098
23 Ga0070704_100110725 3300005549 Bacteria 2089
24 Ga0068856_100689641 3300005614 Bacteria 1042
25 Ga0068859_100071337 3300005617 Bacteria 3510
26 Ga0068859_100604788 3300005617 Bacteria 1189
27 Ga0068859_101561686 3300005617 Bacteria 729
28 Ga0068864_100307262 3300005618 Bacteria 1486
29 Ga0068863_100091000 3300005841 Bacteria 2893
30 Ga0075365_10080931 3300006038 Bacteria 2200
31 Ga0075428_100782127 3300006844 Bacteria 1015
32 Ga0075433_10395367 3300006852 Bacteria 1220
33 Ga0075433_11259769 3300006852 Bacteria 641
34 Ga0075434_101110475 3300006871 Bacteria 804
35 Ga0075434_101529793 3300006871 Bacteria 676
36 Ga0075436_100005151 3300006914 Bacteria 8999
37 Ga0097620_100071336 3300006931 Bacteria 3510
38 Ga0097620_100604906 3300006931 Bacteria 1189
39 Ga0097620_101561694 3300006931 Bacteria 729
40 Ga0075435_100270390 3300007076 Bacteria 1450
41 Ga0099794_10634563 3300007265 Bacteria 567
42 Ga0105240_11857847 3300009093 Bacteria 627
43 Ga0111539_10033930 3300009094 Bacteria 6193
44 Ga0111539_10059554 3300009094 Bacteria 4527
45 Ga0114129_12489267 3300009147 Bacteria 619
46 Ga0105241_11620199 3300009174 Bacteria 627
47 Ga0105242_11008299 3300009176 Bacteria 841
48 Ga0105238_10219278 3300009551 Bacteria 1878
49 Ga0105249_10183821 3300009553 Bacteria 2036
50 Ga0105239_10612236 3300010375 Bacteria 1243
51 Ga0157370_10497472 3300013104 Bacteria 1120
52 Ga0157369_10647415 3300013105 Bacteria 1090
53 Ga0163162_10187952 3300013306 Bacteria 2193
54 Ga0157372_10079007 3300013307 Bacteria 3719
55 Ga0157372_10306242 3300013307 Bacteria 1849
56 Ga0157372_11903302 3300013307 Bacteria 684
57 Ga0157380_10698030 3300014326 Bacteria 1019
58 Ga0157377_10782867 3300014745 Bacteria 701
59 Ga0163161_11039235 3300017792 Bacteria 701
60 Ga0197907_10730519 3300020069 Bacteria 1223
61 Ga0206350_11187699 3300020080 Bacteria 792
62 Ga0206353_10196483 3300020082 Bacteria 952
63 Ga0224712_10330497 3300022467 Bacteria 717
64 Ga0224712_10332805 3300022467 Bacteria 715
65 Ga0207647_10323865 3300025904 Bacteria 875
66 Ga0207699_10239972 3300025906 Bacteria 1245
67 Ga0207705_10025482 3300025909 Bacteria 4221
68 Ga0207684_11218870 3300025910 Bacteria 622
69 Ga0207695_10788057 3300025913 Bacteria 830
70 Ga0207652_10594399 3300025921 Bacteria 993
71 Ga0207652_11181039 3300025921 Bacteria 667
72 Ga0207681_10289782 3300025923 Bacteria 1292
73 Ga0207659_11258198 3300025926 Bacteria 636
74 Ga0207664_10018071 3300025929 Bacteria 5181
75 Ga0207664_10496977 3300025929 Bacteria 1092
76 Ga0207689_10352879 3300025942 Bacteria 1223
77 Ga0207667_10484403 3300025949 Bacteria 1255
78 Ga0207712_10390043 3300025961 Bacteria 1168
79 Ga0207675_101042068 3300026118 Bacteria 837
80 Ga0268266_10362504 3300028379 Bacteria 1364
81 Ga0265320_10128714 3300031240 Bacteria 1151
82 Ga0307408_100042971 3300031548 Bacteria 3214
83 Ga0307406_10212947 3300031901 Bacteria 1431
84 Ga0373952_0285591 3300035092 Bacteria 510
85 Ga0373941_0299023 3300035115 Bacteria 642
86 Ga0373931_0563305 3300035691 Bacteria 741
87 Ga0373937_1645005 3300036401 Bacteria 589
88 Ga0395900_0476501 3300037418 Bacteria 1201
89 Ga0395905_0004533 3300037471 Bacteria 14386
90 Ga0436362_0490275 3300039453 Bacteria 558
91 Ga0451800_1323568 3300041459 Bacteria 1021
92 Ga0451802_0497540 3300041460 Bacteria 728
93 Ga0451843_0618270 3300041509 Bacteria 1162
94 Ga0451577_0754396 3300042876 Bacteria 880
95 Ga0466963_1261399 3300044694 Bacteria 519
96 Ga0453684_0203494 3300044712 Bacteria 2306
97 Ga0453684_0249034 3300044712 Bacteria 2041
98 Ga0466957_0667945 3300044842 Bacteria 732
99 Ga0451576_0357382 3300045051 Bacteria 1529
100 Ga0451576_0455995 3300045051 Bacteria 1342
101 Ga0451576_0478396 3300045051 Bacteria 1308
102 Ga0495592_0311455 3300046454 Bacteria 1020
103 Ga0495653_0586144 3300046463 Bacteria 687
104 Ga0495645_0772683 3300046543 Bacteria 578
105 Ga0495667_0475698 3300046559 Bacteria 784
106 Ga0495657_0673246 3300046675 Bacteria 596
107 Ga0495599_0246344 3300046678 Bacteria 1089
108 Ga0495669_0263191 3300046684 Unclassified 829
109 Ga0495604_0050077 3300047317 Bacteria 3244
110 Ga0495602_1100104 3300048088 Bacteria 521
111 Ga0496117_0411915 3300048920 Unclassified 679
112 Ga0501033_0724994 3300049570 Bacteria 675
113 Ga0501034_0102913 3300049571 Bacteria 2849
114 Ga0501034_0207781 3300049571 Bacteria 1914
115 Ga0501034_0867643 3300049571 Bacteria 792
116 Ga0501034_1237344 3300049571 Bacteria 625
117 Ga0501036_0397556 3300049572 Unclassified 1150
118 Ga0501038_0092002 3300049574 Bacteria 2540
119 Ga0501039_0007889 3300049575 Bacteria 8112
120 Ga0501039_0669354 3300049575 Bacteria 812
121 Ga0501040_0041321 3300049576 Bacteria 3141
122 Ga0501046_0050079 3300049580 Bacteria 3301
123 Ga0501048_0012267 3300049582 Bacteria 6378
124 Ga0501068_0295795 3300049584 Bacteria 1036
125 Ga0501069_0078688 3300049585 Bacteria 1855
126 Ga0501070_0934841 3300049586 Unclassified 675
127 Ga0501072_0024918 3300049588 Bacteria 4658
128 Ga0501073_0351475 3300049589 Bacteria 1018
129 Ga0501074_0256348 3300049590 Bacteria 1244
130 Ga0501075_0134344 3300049591 Bacteria 1884
131 Ga0501075_0311570 3300049591 Bacteria 1199
132 Ga0501076_0093622 3300049592 Bacteria 2418
133 Ga0501077_0028574 3300049593 Bacteria 3545
134 Ga0501077_0051713 3300049593 Bacteria 2610
135 Ga0501079_0011182 3300049741 Bacteria 6846
136 Ga0501079_0011623 3300049741 Bacteria 6723
137 Ga0501081_0050962 3300049743 Bacteria 2853
138 Ga0501081_0710873 3300049743 Bacteria 755
139 Ga0501083_0757124 3300049744 Bacteria 632
140 Ga0501045_0017844 3300049824 Bacteria 5041
141 nmdc:mga0yw44_84322_c1 3300050492 Bacteria 1997
142 nmdc:mga05p37_1154543_c1 3300050507 Unclassified 805
143 nmdc:mga05p37_1793301_c1 3300050507 Bacteria 592
144 nmdc:mga08y16_16567_c1 3300050511 Bacteria 7751
145 nmdc:mga0n895_1493572_c1 3300050512 Bacteria 642
146 nmdc:mga08x19_42058_c1 3300050514 Bacteria 2912
147 nmdc:mga0a205_1198934_c1 3300050515 Bacteria 607
148 nmdc:mga0a205_367288_c1 3300050515 Bacteria 1305
149 Ga0495601_0043977 3300053077 Bacteria 2807
150 Ga0495595_0008425 3300053084 Bacteria 4231
151 Ga0495619_0156178 3300053085 Bacteria 1574
152 Ga0500641_0060082 3300053096 Bacteria 1581
153 Ga0501084_0047906 3300054114 Bacteria 3579
154 Ga0501082_0210639 3300060353 Bacteria 1691
155 Ga0530510_0106204 3300061734 Bacteria 2055
156 Ga0530510_0190901 3300061734 Bacteria 1521
157 Ga0501041_0413718
158 rootH2_10192669
159 Ga0065707_10165791
160 Ga0070658_10007773
161 Ga0068869_100786194
162 Ga0070689_100954421
163 Ga0070692_10646874
164 Ga0070669_100925779
165 Ga0070703_10409504
166 Ga0070714_100097746
167 Ga0070710_10181737
168 Ga0070711_100716742
169 Ga0070708_100020232
170 Ga0070708_100114556
171 Ga0070681_10234945
172 Ga0070698_100009562
173 Ga0070698_101404730
174 Ga0070679_101357617
175 Ga0070695_100001370
176 Ga0070693_100726839
177 Ga0070665_100420058
178 Ga0070704_100109610
179 Ga0070704_100110725
180 Ga0068856_100689641
181 Ga0068859_100071337
182 Ga0068859_100604788
183 Ga0068859_101561686
184 Ga0068864_100307262
185 Ga0068863_100091000
186 Ga0075365_10080931
187 Ga0075428_100782127
188 Ga0075433_10395367
189 Ga0075433_11259769
190 Ga0075434_101110475
191 Ga0075434_101529793
192 Ga0075436_100005151
193 Ga0097620_100071336
194 Ga0097620_100604906
195 Ga0097620_101561694
196 Ga0075435_100270390
197 Ga0099794_10634563
198 Ga0105240_11857847
199 Ga0111539_10033930
200 Ga0111539_10059554
201 Ga0114129_12489267
202 Ga0105241_11620199
203 Ga0105242_11008299
204 Ga0105238_10219278
205 Ga0105249_10183821
206 Ga0105239_10612236
207 Ga0157370_10497472
208 Ga0157369_10647415
209 Ga0163162_10187952
210 Ga0157372_10079007
211 Ga0157372_10306242
212 Ga0157372_11903302
213 Ga0157380_10698030
214 Ga0157377_10782867
215 Ga0163161_11039235
216 Ga0197907_10730519
217 Ga0206350_11187699
218 Ga0206353_10196483
219 Ga0224712_10330497
220 Ga0224712_10332805
221 Ga0207647_10323865
222 Ga0207699_10239972
223 Ga0207705_10025482
224 Ga0207684_11218870
225 Ga0207695_10788057
226 Ga0207652_10594399
227 Ga0207652_11181039
228 Ga0207681_10289782
229 Ga0207659_11258198
230 Ga0207664_10018071
231 Ga0207664_10496977
232 Ga0207689_10352879
233 Ga0207667_10484403
234 Ga0207712_10390043
235 Ga0207675_101042068
236 Ga0268266_10362504
237 Ga0265320_10128714
238 Ga0307408_100042971
239 Ga0307406_10212947
240 Ga0373952_0285591
241 Ga0373941_0299023
242 Ga0373931_0563305
243 Ga0373937_1645005
244 Ga0395900_0476501
245 Ga0395905_0004533
246 Ga0436362_0490275
247 Ga0451800_1323568
248 Ga0451802_0497540
249 Ga0451843_0618270
250 Ga0451577_0754396
251 Ga0466963_1261399
252 Ga0453684_0203494
253 Ga0453684_0249034
254 Ga0466957_0667945
255 Ga0451576_0357382
256 Ga0451576_0455995
257 Ga0451576_0478396
258 Ga0495592_0311455
259 Ga0495653_0586144
260 Ga0495645_0772683
261 Ga0495667_0475698
262 Ga0495657_0673246
263 Ga0495599_0246344
264 Ga0495669_0263191
265 Ga0495604_0050077
266 Ga0495602_1100104
267 Ga0496117_0411915
268 Ga0501033_0724994
269 Ga0501034_0102913
270 Ga0501034_0207781
271 Ga0501034_0867643
272 Ga0501034_1237344
273 Ga0501036_0397556
274 Ga0501038_0092002
275 Ga0501039_0007889
276 Ga0501039_0669354
277 Ga0501040_0041321
278 Ga0501046_0050079
279 Ga0501048_0012267
280 Ga0501068_0295795
281 Ga0501069_0078688
282 Ga0501070_0934841
283 Ga0501072_0024918
284 Ga0501073_0351475
285 Ga0501074_0256348
286 Ga0501075_0134344
287 Ga0501075_0311570
288 Ga0501076_0093622
289 Ga0501077_0028574
290 Ga0501077_0051713
291 Ga0501079_0011182
292 Ga0501079_0011623
293 Ga0501081_0050962
294 Ga0501081_0710873
295 Ga0501083_0757124
296 Ga0501045_0017844
297 nmdc:mga0yw44_84322_c1
298 nmdc:mga05p37_1154543_c1
299 nmdc:mga05p37_1793301_c1
300 nmdc:mga08y16_16567_c1
301 nmdc:mga0n895_1493572_c1
302 nmdc:mga08x19_42058_c1
303 nmdc:mga0a205_1198934_c1
304 nmdc:mga0a205_367288_c1
305 Ga0495601_0043977
306 Ga0495595_0008425
307 Ga0495619_0156178
308 Ga0500641_0060082
309 Ga0501084_0047906
310 Ga0501082_0210639
311 Ga0530510_0106204
312 Ga0530510_0190901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

69

168

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9655 1 137
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9606 1 137
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9592 1 137
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9586 1 137
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9583 1 137
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9546 1 137 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9479 1 137 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9111 45 136 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.908 4 136 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9079 1 136 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 0.9871 43 137 GO:0004601
GO:0006979
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.9857 42 136 GO:0004601
GO:0006979
AF-A0A520BIH8-F1-model_v4 OsmC family peroxiredoxin 0.985 54 136 GO:0004601
GO:0006979
AF-A0A4P5TX77-F1-model_v4 Peroxiredoxin 0.9849 1 136 GO:0004601
GO:0006979
AF-A0A1J5SMX0-F1-model_v4 Peroxiredoxin OsmC (EC 1.11.1.15) 0.9839 60 136 GO:0004601

Map