F225683

General Info

Members Datasets Scaffolds Average Seq Length
156 106 156 121

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0343368|Ga0495636_0343368_252_665
Length 137
Sequence MDRIFVKKFSSPDERRPFKDKGHLDVINVGEGIVGRAIFEPGWKWSEHVKPLAGTDSCETAHATYVVSGRIHIVMNDGESRDLGPGDFAMIPPGHDAWVVGDEPCVMFDFGGVANYAKRADERPIERRAVDEVPSIH

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
49 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
50 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
60 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
61 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
62 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
105 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 2.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.69
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 17.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11675569 3300004798 Unclassified 562
2 Ga0070680_100521765 3300005336 Bacteria 1017
3 Ga0070661_100956070 3300005344 Bacteria 709
4 Ga0070671_101596199 3300005355 Bacteria 578
5 Ga0070714_100009241 3300005435 Bacteria 7744
6 Ga0070714_100120316 3300005435 Bacteria 2335
7 Ga0070714_100194035 3300005435 Bacteria 1855
8 Ga0070714_100652581 3300005435 Bacteria 1013
9 Ga0070713_100046136 3300005436 Bacteria 3574
10 Ga0070710_10286013 3300005437 Unclassified 1071
11 Ga0070710_10646315 3300005437 Bacteria 741
12 Ga0070711_100683409 3300005439 Unclassified 863
13 Ga0070681_10401631 3300005458 Bacteria 1282
14 Ga0070706_101901078 3300005467 Archaea 540
15 Ga0070679_100394472 3300005530 Bacteria 1330
16 Ga0070684_102327007 3300005535 Bacteria 505
17 Ga0070693_100384661 3300005547 Bacteria 969
18 Ga0068854_100807482 3300005578 Bacteria 818
19 Ga0068856_100237004 3300005614 Bacteria 1840
20 Ga0068861_101867363 3300005719 Bacteria 597
21 Ga0081455_10028308 3300005937 Bacteria 5121
22 Ga0081455_10075898 3300005937 Bacteria 2771
23 Ga0070717_10637509 3300006028 Bacteria 967
24 Ga0070716_100376376 3300006173 Bacteria 1013
25 Ga0070716_101117900 3300006173 Bacteria 629
26 Ga0070716_101136724 3300006173 Bacteria 624
27 Ga0070712_100034924 3300006175 Bacteria 3410
28 Ga0070712_100312720 3300006175 Bacteria 1275
29 Ga0070712_100344476 3300006175 Bacteria 1218
30 Ga0075430_100000684 3300006846 Bacteria 25907
31 Ga0075434_100487294 3300006871 Bacteria 1254
32 Ga0105240_10010785 3300009093 Bacteria 12807
33 Ga0105243_11207660 3300009148 Unclassified 770
34 Ga0105243_11688401 3300009148 Bacteria 662
35 Ga0105242_12083088 3300009176 Bacteria 611
36 Ga0157374_11208822 3300013296 Bacteria 777
37 Ga0157378_11075471 3300013297 Bacteria 841
38 Ga0206356_10615673 3300020070 Unclassified 662
39 Ga0154015_1660094 3300020610 Bacteria 521
40 Ga0213873_10055059 3300021358 Bacteria 1063
41 Ga0213876_10001028 3300021384 Bacteria 18005
42 Ga0213876_10007060 3300021384 Bacteria 6125
43 Ga0213876_10026244 3300021384 Bacteria 3073
44 Ga0213876_10036259 3300021384 Bacteria 2602
45 Ga0213876_10118044 3300021384 Bacteria 1408
46 Ga0213876_10419316 3300021384 Bacteria 712
47 Ga0213875_10014395 3300021388 Bacteria 3859
48 Ga0213875_10049334 3300021388 Bacteria 1973
49 Ga0213875_10341594 3300021388 Unclassified 711
50 Ga0207692_10136756 3300025898 Bacteria 1390
51 Ga0207642_10712829 3300025899 Unclassified 633
52 Ga0207695_10008272 3300025913 Bacteria 13048
53 Ga0207693_10293750 3300025915 Bacteria 1273
54 Ga0207663_10130276 3300025916 Bacteria 1737
55 Ga0207660_10394710 3300025917 Bacteria 1114
56 Ga0207649_10716056 3300025920 Bacteria 777
57 Ga0207652_10575250 3300025921 Bacteria 1011
58 Ga0207700_10000002 3300025928 Bacteria 775978
59 Ga0207700_10617676 3300025928 Bacteria 965
60 Ga0207664_10007278 3300025929 Bacteria 7677
61 Ga0207664_10150637 3300025929 Bacteria 1976
62 Ga0207664_10187798 3300025929 Bacteria 1778
63 Ga0207664_11265688 3300025929 Bacteria 657
64 Ga0207644_10793730 3300025931 Bacteria 792
65 Ga0207665_11166558 3300025939 Bacteria 614
66 Ga0207703_10680992 3300026035 Bacteria 977
67 Ga0207702_10188909 3300026078 Unclassified 1902
68 Ga0265314_10599112 3300031711 Bacteria 568
69 Ga0373943_0410875 3300035170 Bacteria 782
70 Ga0373946_0134918 3300035171 Bacteria 1139
71 Ga0373935_0203018 3300035692 Bacteria 1371
72 Ga0373937_1500166 3300036401 Bacteria 622
73 Ga0373925_0023426 3300037068 Bacteria 4504
74 Ga0395899_0727310 3300037312 Bacteria 620
75 Ga0395898_0078704 3300037466 Bacteria 3181
76 Ga0395898_0950603 3300037466 Bacteria 796
77 Ga0395905_0286901 3300037471 Bacteria 1533
78 Ga0436364_0113665 3300037853 Unclassified 1112
79 Ga0436364_0336790 3300037853 Bacteria 4084
80 Ga0436364_0409171 3300037853 Bacteria 12927
81 Ga0436364_0751605 3300037853 Unclassified 908
82 Ga0436364_1075830 3300037853 Bacteria 3990
83 Ga0395901_0346638 3300038443 Bacteria 1533
84 Ga0395901_0461166 3300038443 Bacteria 1298
85 Ga0395901_1689276 3300038443 Bacteria 585
86 Ga0436365_0259350 3300039437 Bacteria 1189
87 Ga0436365_0425235 3300039437 Bacteria 4058
88 Ga0436365_0685963 3300039437 Bacteria 4794
89 Ga0436365_0739519 3300039437 Bacteria 709
90 Ga0436365_1010680 3300039437 Bacteria 3017
91 Ga0436365_1226408 3300039437 Bacteria 29819
92 Ga0436365_1794126 3300039437 Bacteria 3288
93 Ga0436365_1824682 3300039437 Unclassified 675
94 Ga0436363_0312547 3300039450 Bacteria 955
95 Ga0436362_0410984 3300039453 Bacteria 1892
96 Ga0436362_0880745 3300039453 Bacteria 652
97 Ga0436362_1011894 3300039453 Bacteria 3321
98 Ga0436362_1201566 3300039453 Unclassified 552
99 Ga0451839_0770804 3300041496 Bacteria 516
100 Ga0451841_0186072 3300041498 Bacteria 557
101 Ga0451853_0445602 3300041512 Bacteria 1592
102 Ga0466965_0077491 3300044683 Bacteria 1679
103 Ga0466965_0349038 3300044683 Unclassified 810
104 Ga0466963_0890195 3300044694 Bacteria 627
105 Ga0466964_0270011 3300044706 Bacteria 846
106 Ga0466968_0015661 3300044735 Bacteria 3009
107 Ga0466968_0033350 3300044735 Bacteria 2146
108 Ga0466968_0132598 3300044735 Bacteria 1135
109 Ga0466957_0021682 3300044842 Unclassified 3786
110 Ga0466959_0073575 3300045049 Bacteria 2472
111 Ga0466959_0105986 3300045049 Bacteria 2010
112 Ga0466958_0009339 3300045836 Bacteria 5464
113 Ga0466958_0160319 3300045836 Bacteria 1421
114 Ga0466967_0294633 3300045976 Bacteria 1559
115 Ga0495592_0259279 3300046454 Bacteria 1146
116 Ga0495641_0421750 3300046461 Unclassified 606
117 Ga0495653_0000108 3300046463 Bacteria 69201
118 Ga0495664_0000007 3300046477 Bacteria 386710
119 Ga0495618_0009322 3300046514 Bacteria 5924
120 Ga0495630_0005016 3300046517 Bacteria 9314
121 Ga0495630_0389518 3300046517 Bacteria 1067
122 Ga0495652_0492321 3300046529 Unclassified 851
123 Ga0495652_0690213 3300046529 Unclassified 688
124 Ga0495645_0760195 3300046543 Bacteria 584
125 Ga0495667_0199502 3300046559 Bacteria 1281
126 Ga0495657_0000101 3300046675 Bacteria 75924
127 Ga0495646_0665063 3300046680 Bacteria 526
128 Ga0495658_0712391 3300046683 Bacteria 643
129 Ga0495600_0079570 3300046809 Unclassified 2140
130 Ga0495604_0001973 3300047317 Bacteria 16549
131 Ga0495636_0343368 3300047318 Bacteria 704
132 Ga0495674_0522824 3300047319 Bacteria 947
133 Ga0495676_0306580 3300047321 Bacteria 1070
134 Ga0495684_0015205 3300047471 Bacteria 5927
135 Ga0495684_0033664 3300047471 Unclassified 3930
136 Ga0496102_0000002 3300048905 Bacteria 814588
137 Ga0496103_0000046 3300048906 Bacteria 161981
138 Ga0496104_0000033 3300048907 Bacteria 189758
139 Ga0496104_0667112 3300048907 Unclassified 948
140 Ga0496104_1513885 3300048907 Bacteria 574
141 Ga0496105_0802613 3300048908 Bacteria 715
142 Ga0496110_0000046 3300048913 Bacteria 60653
143 Ga0496110_0063387 3300048913 Bacteria 3266
144 Ga0496111_0000372 3300048914 Bacteria 22335
145 Ga0496111_0309733 3300048914 Bacteria 1170
146 Ga0496112_1453983 3300048915 Bacteria 600
147 Ga0496113_0440408 3300048916 Bacteria 1047
148 Ga0501042_1206161 3300049578 Bacteria 552
149 Ga0501075_0880687 3300049591 Bacteria 681
150 nmdc:mga0qj67_3685_c1 3300050509 Bacteria 11065
151 nmdc:mga0n895_1003153_c1 3300050512 Bacteria 816
152 Ga0495601_0003176 3300053077 Bacteria 9409
153 Ga0495595_0565779 3300053084 Bacteria 581
154 Ga0495619_1105560 3300053085 Bacteria 527
155 Ga0587069_103496 3300059642 Unclassified 584
156 Ga0466962_0033369 3300061719 Unclassified 2462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046680 Ga0495646_0665063 Ga0495646_0665063_26_328 100
2 3300006871 Ga0075434_100487294 Ga0075434_1004872942 103
3 3300050512 nmdc:mga0n895_1003153_c1 nmdc:mga0n895_1003153_c1_342_704 105
4 3300053084 Ga0495595_0565779 Ga0495595_0565779_238_561 107
5 3300041498 Ga0451841_0186072 Ga0451841_0186072_184_534 116
6 3300005355 Ga0070671_101596199 Ga0070671_1015961992 118
7 3300005437 Ga0070710_10286013 Ga0070710_102860131 118
8 3300006175 Ga0070712_100034924 Ga0070712_1000349246 118
9 3300009176 Ga0105242_12083088 Ga0105242_120830881 118
10 3300021384 Ga0213876_10007060 Ga0213876_100070606 118
11 3300025931 Ga0207644_10793730 Ga0207644_107937301 118
12 3300039437 Ga0436365_1010680 Ga0436365_1010680_1973_2329 118
13 3300044683 Ga0466965_0349038 Ga0466965_0349038_180_536 118
14 3300044735 Ga0466968_0015661 Ga0466968_0015661_2074_2430 118
15 3300045049 Ga0466959_0073575 Ga0466959_0073575_983_1339 118
16 3300020610 Ga0154015_1660094 Ga0154015_16600941 119
17 3300021384 Ga0213876_10419316 Ga0213876_104193161 119
18 3300025928 Ga0207700_10617676 Ga0207700_106176761 119
19 3300025929 Ga0207664_11265688 Ga0207664_112656881 119
20 3300035170 Ga0373943_0410875 Ga0373943_0410875_161_520 119
21 3300035171 Ga0373946_0134918 Ga0373946_0134918_321_680 119
22 3300035692 Ga0373935_0203018 Ga0373935_0203018_825_1184 119
23 3300037068 Ga0373925_0023426 Ga0373925_0023426_1267_1626 119
24 3300039437 Ga0436365_0259350 Ga0436365_0259350_521_880 119
25 3300039437 Ga0436365_0739519 Ga0436365_0739519_307_666 119
26 3300039453 Ga0436362_0880745 Ga0436362_0880745_270_629 119
27 3300005435 Ga0070714_100009241 Ga0070714_1000092419 120
28 3300005435 Ga0070714_100652581 Ga0070714_1006525812 120
29 3300005436 Ga0070713_100046136 Ga0070713_1000461365 120
30 3300005937 Ga0081455_10028308 Ga0081455_100283088 120
31 3300006173 Ga0070716_100376376 Ga0070716_1003763763 120
32 3300006175 Ga0070712_100312720 Ga0070712_1003127202 120
33 3300021388 Ga0213875_10014395 Ga0213875_100143952 120
34 3300025915 Ga0207693_10293750 Ga0207693_102937502 120
35 3300025928 Ga0207700_10000002 Ga0207700_1000000230 120
36 3300025929 Ga0207664_10007278 Ga0207664_100072783 120
37 3300031711 Ga0265314_10599112 Ga0265314_105991121 120
38 3300036401 Ga0373937_1500166 Ga0373937_1500166_58_420 120
39 3300037853 Ga0436364_0336790 Ga0436364_0336790_187_552 120
40 3300038443 Ga0395901_1689276 Ga0395901_1689276_151_513 120
41 3300044842 Ga0466957_0021682 Ga0466957_0021682_2209_2571 120
42 3300045836 Ga0466958_0009339 Ga0466958_0009339_1420_1782 120
43 3300047318 Ga0495636_0343368 Ga0495636_0343368_252_665 120
44 3300047321 Ga0495676_0306580 Ga0495676_0306580_53_415 120
45 3300048907 Ga0496104_0667112 Ga0496104_0667112_326_688 120
46 3300048913 Ga0496110_0063387 Ga0496110_0063387_374_736 120
47 3300048914 Ga0496111_0309733 Ga0496111_0309733_344_706 120
48 3300048915 Ga0496112_1453983 Ga0496112_1453983_222_584 120
49 3300048916 Ga0496113_0440408 Ga0496113_0440408_55_417 120
50 3300049578 Ga0501042_1206161 Ga0501042_1206161_31_396 120
51 3300059642 Ga0587069_103496 Ga0587069_103496_85_447 120
52 3300061719 Ga0466962_0033369 Ga0466962_0033369_1953_2315 120
53 3300005336 Ga0070680_100521765 Ga0070680_1005217652 121
54 3300005344 Ga0070661_100956070 Ga0070661_1009560701 121
55 3300005435 Ga0070714_100120316 Ga0070714_1001203163 121
56 3300005435 Ga0070714_100194035 Ga0070714_1001940352 121
57 3300005437 Ga0070710_10646315 Ga0070710_106463152 121
58 3300005439 Ga0070711_100683409 Ga0070711_1006834092 121
59 3300005458 Ga0070681_10401631 Ga0070681_104016312 121
60 3300005467 Ga0070706_101901078 Ga0070706_1019010781 121
61 3300005530 Ga0070679_100394472 Ga0070679_1003944721 121
62 3300005535 Ga0070684_102327007 Ga0070684_1023270071 121
63 3300005547 Ga0070693_100384661 Ga0070693_1003846611 121
64 3300005578 Ga0068854_100807482 Ga0068854_1008074822 121
65 3300005614 Ga0068856_100237004 Ga0068856_1002370042 121
66 3300005719 Ga0068861_101867363 Ga0068861_1018673631 121
67 3300005937 Ga0081455_10075898 Ga0081455_100758983 121
68 3300006028 Ga0070717_10637509 Ga0070717_106375091 121
69 3300006173 Ga0070716_101117900 Ga0070716_1011179001 121
70 3300006173 Ga0070716_101136724 Ga0070716_1011367241 121
71 3300006175 Ga0070712_100344476 Ga0070712_1003444762 121
72 3300006846 Ga0075430_100000684 Ga0075430_1000006849 121
73 3300009093 Ga0105240_10010785 Ga0105240_100107858 121
74 3300009148 Ga0105243_11207660 Ga0105243_112076601 121
75 3300009148 Ga0105243_11688401 Ga0105243_116884012 121
76 3300013296 Ga0157374_11208822 Ga0157374_112088222 121
77 3300013297 Ga0157378_11075471 Ga0157378_110754712 121
78 3300020070 Ga0206356_10615673 Ga0206356_106156731 121
79 3300021358 Ga0213873_10055059 Ga0213873_100550591 121
80 3300021384 Ga0213876_10001028 Ga0213876_1000102812 121
81 3300021384 Ga0213876_10026244 Ga0213876_100262442 121
82 3300021384 Ga0213876_10036259 Ga0213876_100362592 121
83 3300021384 Ga0213876_10118044 Ga0213876_101180442 121
84 3300021388 Ga0213875_10049334 Ga0213875_100493341 121
85 3300021388 Ga0213875_10341594 Ga0213875_103415942 121
86 3300025898 Ga0207692_10136756 Ga0207692_101367562 121
87 3300025899 Ga0207642_10712829 Ga0207642_107128292 121
88 3300025913 Ga0207695_10008272 Ga0207695_100082729 121
89 3300025916 Ga0207663_10130276 Ga0207663_101302762 121
90 3300025917 Ga0207660_10394710 Ga0207660_103947102 121
91 3300025920 Ga0207649_10716056 Ga0207649_107160561 121
92 3300025921 Ga0207652_10575250 Ga0207652_105752502 121
93 3300025929 Ga0207664_10150637 Ga0207664_101506372 121
94 3300025929 Ga0207664_10187798 Ga0207664_101877982 121
95 3300025939 Ga0207665_11166558 Ga0207665_111665582 121
96 3300026078 Ga0207702_10188909 Ga0207702_101889092 121
97 3300037853 Ga0436364_0113665 Ga0436364_0113665_724_1089 121
98 3300037853 Ga0436364_0409171 Ga0436364_0409171_2309_2674 121
99 3300037853 Ga0436364_0751605 Ga0436364_0751605_231_596 121
100 3300037853 Ga0436364_1075830 Ga0436364_1075830_2637_3002 121
101 3300039437 Ga0436365_0425235 Ga0436365_0425235_680_1045 121
102 3300039437 Ga0436365_0685963 Ga0436365_0685963_1982_2347 121
103 3300039437 Ga0436365_1226408 Ga0436365_1226408_20919_21284 121
104 3300039437 Ga0436365_1794126 Ga0436365_1794126_849_1214 121
105 3300039437 Ga0436365_1824682 Ga0436365_1824682_213_578 121
106 3300039450 Ga0436363_0312547 Ga0436363_0312547_102_467 121
107 3300039453 Ga0436362_0410984 Ga0436362_0410984_485_850 121
108 3300039453 Ga0436362_1011894 Ga0436362_1011894_566_931 121
109 3300039453 Ga0436362_1201566 Ga0436362_1201566_50_415 121
110 3300041512 Ga0451853_0445602 Ga0451853_0445602_686_1051 121
111 3300044683 Ga0466965_0077491 Ga0466965_0077491_254_619 121
112 3300044694 Ga0466963_0890195 Ga0466963_0890195_25_390 121
113 3300044735 Ga0466968_0033350 Ga0466968_0033350_1314_1679 121
114 3300044735 Ga0466968_0132598 Ga0466968_0132598_720_1085 121
115 3300045049 Ga0466959_0105986 Ga0466959_0105986_1185_1553 121
116 3300045836 Ga0466958_0160319 Ga0466958_0160319_875_1243 121
117 3300046454 Ga0495592_0259279 Ga0495592_0259279_760_1125 121
118 3300046461 Ga0495641_0421750 Ga0495641_0421750_127_492 121
119 3300046463 Ga0495653_0000108 Ga0495653_0000108_10179_10544 121
120 3300046514 Ga0495618_0009322 Ga0495618_0009322_680_1045 121
121 3300046517 Ga0495630_0005016 Ga0495630_0005016_5251_5616 121
122 3300046517 Ga0495630_0389518 Ga0495630_0389518_489_854 121
123 3300046529 Ga0495652_0690213 Ga0495652_0690213_79_444 121
124 3300046559 Ga0495667_0199502 Ga0495667_0199502_525_890 121
125 3300046675 Ga0495657_0000101 Ga0495657_0000101_51809_52174 121
126 3300046683 Ga0495658_0712391 Ga0495658_0712391_98_463 121
127 3300047317 Ga0495604_0001973 Ga0495604_0001973_13990_14355 121
128 3300047319 Ga0495674_0522824 Ga0495674_0522824_199_564 121
129 3300047471 Ga0495684_0015205 Ga0495684_0015205_479_844 121
130 3300047471 Ga0495684_0033664 Ga0495684_0033664_2253_2618 121
131 3300048905 Ga0496102_0000002 Ga0496102_0000002_677097_677462 121
132 3300048906 Ga0496103_0000046 Ga0496103_0000046_135782_136147 121
133 3300048907 Ga0496104_0000033 Ga0496104_0000033_170863_171228 121
134 3300048907 Ga0496104_1513885 Ga0496104_1513885_116_481 121
135 3300048908 Ga0496105_0802613 Ga0496105_0802613_41_406 121
136 3300048913 Ga0496110_0000046 Ga0496110_0000046_50967_51332 121
137 3300048914 Ga0496111_0000372 Ga0496111_0000372_3669_4034 121
138 3300050509 nmdc:mga0qj67_3685_c1 nmdc:mga0qj67_3685_c1_10026_10391 121
139 3300053077 Ga0495601_0003176 Ga0495601_0003176_8154_8519 121
140 3300053085 Ga0495619_1105560 Ga0495619_1105560_53_418 121
141 3300041496 Ga0451839_0770804 Ga0451839_0770804_121_492 123
142 3300046477 Ga0495664_0000007 Ga0495664_0000007_88541_88915 123
143 3300046529 Ga0495652_0492321 Ga0495652_0492321_396_767 123
144 3300046543 Ga0495645_0760195 Ga0495645_0760195_104_475 123
145 3300046809 Ga0495600_0079570 Ga0495600_0079570_1757_2128 123
146 3300026035 Ga0207703_10680992 Ga0207703_106809922 124
147 3300037312 Ga0395899_0727310 Ga0395899_0727310_19_393 124
148 3300037466 Ga0395898_0078704 Ga0395898_0078704_1434_1808 124
149 3300037466 Ga0395898_0950603 Ga0395898_0950603_259_633 124
150 3300037471 Ga0395905_0286901 Ga0395905_0286901_60_434 124
151 3300038443 Ga0395901_0346638 Ga0395901_0346638_472_846 124
152 3300038443 Ga0395901_0461166 Ga0395901_0461166_367_741 124
153 3300044706 Ga0466964_0270011 Ga0466964_0270011_278_658 125
154 3300045976 Ga0466967_0294633 Ga0466967_0294633_258_638 125
155 3300049591 Ga0501075_0880687 Ga0501075_0880687_43_429 126
156 3300004798 Ga0058859_11675569 Ga0058859_116755691 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

52

111

0.91

PF05899

Cupin_3

EutQ-like cupin domain

43

106

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i45-assembly5.cif.gz_J crystal structure of protein nmb1881 from neisseria meningitidis 0.8133 31 116
2oyz-assembly1.cif.gz_A-2 crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94) 0.8041 20 118
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.7961 20 118
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.7748 25 128
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.7746 38 122
ID Description Score Start End Superfamily
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.806 20 118 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7903 20 118 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7846 29 120 2.60.120.10
af_Q55GT9_408_527_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.7778 19 46 3.10.110.10
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7759 20 118 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A133LL57-F1-model_v4 Cupin domain-containing protein 0.9836 9 127
AF-A0A6V8KDT5-F1-model_v4 Cupin 0.9799 9 128
AF-A0A1Q8JJJ2-F1-model_v4 Cupin type-2 domain-containing protein 0.9789 3 126
AF-A0A7W1CNK3-F1-model_v4 Cupin domain-containing protein 0.9779 20 118
AF-A0A6B3LLY1-F1-model_v4 Cupin 0.9776 8 128

Feature Viewer

pLDDT pTM Quality
92.22 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map