F225645

General Info

Members Datasets Scaffolds Average Seq Length
156 128 312 306

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0160099|Ga0495643_0160099_44_1087
Length 347
Sequence LLFTKAHRPITPRAQNVLHQNFVGSRLLKEDSLKYILCIIAAFAYTNVHAAAWQPANGHKQLPIWPGVIPDAKSATGPEDEMTLREERLIAERPWLEVANVTRPTMTIYSPKGRNTGAAVIVFPGGGYRVLAIDLEGTEVCDWLTSIGVTCVLLKYRVPGSGPHWDTIRNIRVIPKTHTALQDAQRTLGLIRHNAADWKIDPNKIGVLGFSAGGHLVASISTHHKRIYAPVDKADEESCRPDFAVSLYPGHMSVNYKADLSKLNPTIRVTSQTPPTFLLHAQDDPVDPVEFSLLYYAALKKENIPVEMHLFAHGGHAFGLRTTKFPITKWPMLVETWLGTIGMVPGK

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
70 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
73 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
74 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
86 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
125 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
126 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
127 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
128 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 2.56
Rhizosphere 80.77
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0160099 3300046522 Bacteria 1108
2 rootH2_10080223 3300003320 Bacteria 3578
3 Ga0055526_1000161 3300003771 Bacteria 59705
4 Ga0070670_100021858 3300005331 Bacteria 5503
5 Ga0068869_100035278 3300005334 Bacteria 3544
6 Ga0070682_100000456 3300005337 Bacteria 25780
7 Ga0070689_100000026 3300005340 Bacteria 100274
8 Ga0070669_100055827 3300005353 Unclassified 2894
9 Ga0070669_100306461 3300005353 Bacteria 1279
10 Ga0070673_100254753 3300005364 Bacteria 1531
11 Ga0070688_100000198 3300005365 Bacteria 31982
12 Ga0070714_100188061 3300005435 Bacteria 1883
13 Ga0070711_100033154 3300005439 Bacteria 3438
14 Ga0070700_100196150 3300005441 Bacteria 1415
15 Ga0070700_100236293 3300005441 Bacteria 1303
16 Ga0070694_100132973 3300005444 Bacteria 1799
17 Ga0070681_10022737 3300005458 Bacteria 6300
18 Ga0070698_100049208 3300005471 Bacteria 4304
19 Ga0070684_100127753 3300005535 Bacteria 2291
20 Ga0068853_100283028 3300005539 Bacteria 1529
21 Ga0070672_100323033 3300005543 Bacteria 1312
22 Ga0070686_100029362 3300005544 Bacteria 3344
23 Ga0070665_100003832 3300005548 Bacteria 15918
24 Ga0068855_100162116 3300005563 Bacteria 2537
25 Ga0070664_100059035 3300005564 Bacteria 3264
26 Ga0068857_100011542 3300005577 Bacteria 7687
27 Ga0068857_100139701 3300005577 Unclassified 2189
28 Ga0068862_100009100 3300005844 Bacteria 8221
29 Ga0070717_10159409 3300006028 Bacteria 1957
30 Ga0075428_100049733 3300006844 Bacteria 4600
31 Ga0105240_10632017 3300009093 Bacteria 1175
32 Ga0105240_10759174 3300009093 Bacteria 1054
33 Ga0114129_10052006 3300009147 Bacteria 5750
34 Ga0114129_10080612 3300009147 Bacteria 4524
35 Ga0114129_10096859 3300009147 Bacteria 4084
36 Ga0105243_10165811 3300009148 Bacteria 1909
37 Ga0105238_10102458 3300009551 Bacteria 2844
38 Ga0105238_10162126 3300009551 Bacteria 2212
39 Ga0105239_10076372 3300010375 Bacteria 3684
40 Ga0105246_10269930 3300011119 Unclassified 1359
41 Ga0157374_10019464 3300013296 Bacteria 6008
42 Ga0163162_10015107 3300013306 Bacteria 7540
43 Ga0157372_10098786 3300013307 Bacteria 3330
44 Ga0157372_10383547 3300013307 Unclassified 1637
45 Ga0157377_10000155 3300014745 Bacteria 42108
46 Ga0157379_10141301 3300014968 Bacteria 2170
47 Ga0209564_1000006 3300025295 Bacteria 1100927
48 Ga0207654_10136084 3300025911 Bacteria 1561
49 Ga0207695_10433118 3300025913 Bacteria 1199
50 Ga0207663_10047871 3300025916 Bacteria 2642
51 Ga0207662_10107303 3300025918 Bacteria 1737
52 Ga0207681_10232773 3300025923 Bacteria 1431
53 Ga0207694_10124042 3300025924 Bacteria 2064
54 Ga0207694_10139635 3300025924 Unclassified 1948
55 Ga0207650_10012900 3300025925 Bacteria 5775
56 Ga0207664_10233769 3300025929 Bacteria 1598
57 Ga0207670_10000021 3300025936 Bacteria 155646
58 Ga0207670_10058752 3300025936 Bacteria 2613
59 Ga0207651_10148913 3300025960 Bacteria 1819
60 Ga0207651_10360422 3300025960 Bacteria 1227
61 Ga0207708_10229825 3300026075 Bacteria 1489
62 Ga0207674_10162519 3300026116 Unclassified 2187
63 Ga0268265_10220737 3300028380 Bacteria 1658
64 Ga0265330_10014771 3300031235 Unclassified 3622
65 Ga0265339_10112217 3300031249 Unclassified 1409
66 Ga0265327_10004015 3300031251 Bacteria 13397
67 Ga0265316_10012396 3300031344 Bacteria 7649
68 Ga0307513_10074614 3300031456 Bacteria 3526
69 Ga0265314_10000867 3300031711 Bacteria 35938
70 Ga0265342_10004915 3300031712 Bacteria 10336
71 Ga0265342_10059576 3300031712 Unclassified 2255
72 Ga0307510_10000006 3300033180 Bacteria 566474
73 Ga0316582_0102754 3300036647 Bacteria 1895
74 Ga0395905_0003769 3300037471 Bacteria 16058
75 Ga0439434_0009434 3300042435 Unclassified 2869
76 Ga0453684_0002537 3300044712 Bacteria 43991
77 Ga0453684_0358615 3300044712 Bacteria 1642
78 Ga0495629_0113305 3300046459 Bacteria 1890
79 Ga0495638_0202207 3300046460 Bacteria 1121
80 Ga0495582_0027133 3300046473 Bacteria 3138
81 Ga0495664_0007940 3300046477 Bacteria 5906
82 Ga0495585_0038341 3300046492 Bacteria 2697
83 Ga0495594_0000883 3300046499 Bacteria 15463
84 Ga0495607_0000080 3300046501 Bacteria 97217
85 Ga0495583_0041161 3300046506 Bacteria 2166
86 Ga0495606_0052966 3300046507 Bacteria 2635
87 Ga0495606_0101932 3300046507 Bacteria 1746
88 Ga0495606_0126399 3300046507 Bacteria 1524
89 Ga0495606_0195134 3300046507 Bacteria 1158
90 Ga0495610_0079265 3300046512 Bacteria 1512
91 Ga0495616_0123957 3300046513 Bacteria 1190
92 Ga0495620_0033798 3300046515 Bacteria 2317
93 Ga0495642_0021250 3300046528 Bacteria 2552
94 Ga0495665_0001508 3300046531 Bacteria 12451
95 Ga0495640_0025234 3300046533 Bacteria 4314
96 Ga0495633_0066012 3300046558 Bacteria 1690
97 Ga0495667_0197778 3300046559 Bacteria 1287
98 Ga0495656_0048548 3300046615 Unclassified 1804
99 Ga0495634_0084598 3300046642 Bacteria 2068
100 Ga0495635_0023939 3300046663 Bacteria 4256
101 Ga0495661_0023380 3300046665 Bacteria 4013
102 Ga0495646_0035872 3300046680 Bacteria 3073
103 Ga0495613_0032285 3300046689 Bacteria 3888
104 Ga0495670_0001069 3300046691 Bacteria 13293
105 Ga0495670_0034157 3300046691 Bacteria 2532
106 Ga0495600_0024534 3300046809 Bacteria 3882
107 Ga0495660_0117155 3300046810 Bacteria 1352
108 Ga0495581_0003903 3300047315 Bacteria 8580
109 Ga0495604_0035246 3300047317 Bacteria 3952
110 Ga0495676_0043579 3300047321 Bacteria 3669
111 Ga0495683_0051987 3300047323 Bacteria 2046
112 Ga0495675_0093166 3300047444 Bacteria 1890
113 Ga0495686_0063069 3300047472 Bacteria 2297
114 Ga0495593_0015746 3300047673 Bacteria 4275
115 Ga0495614_0009430 3300048089 Bacteria 4315
116 Ga0496102_0064407 3300048905 Bacteria 3357
117 Ga0496106_0708021 3300048909 Unclassified 802
118 Ga0496110_0309680 3300048913 Unclassified 1438
119 Ga0496114_0217515 3300048917 Unclassified 1677
120 Ga0496116_0096913 3300048919 Bacteria 1775
121 Ga0496116_0140451 3300048919 Bacteria 1360
122 Ga0496117_0000090 3300048920 Bacteria 206388
123 Ga0496117_0009567 3300048920 Bacteria 8988
124 Ga0496118_0000032 3300048921 Bacteria 330072
125 Ga0496118_0000914 3300048921 Bacteria 46139
126 Ga0496118_0005016 3300048921 Bacteria 15290
127 Ga0496119_0011056 3300048922 Bacteria 7524
128 Ga0496120_0036465 3300048923 Bacteria 2926
129 Ga0496120_0133480 3300048923 Unclassified 1268
130 Ga0496121_0081039 3300048924 Bacteria 2570
131 Ga0496122_0035717 3300048925 Bacteria 4037
132 Ga0496123_0036423 3300048926 Bacteria 3490
133 Ga0496124_0000343 3300048927 Bacteria 85220
134 Ga0496124_0000482 3300048927 Bacteria 68586
135 Ga0496125_0038662 3300048928 Bacteria 4125
136 Ga0496126_0001814 3300048929 Bacteria 31238
137 Ga0501031_0060277 3300049568 Bacteria 2473
138 Ga0501033_0097977 3300049570 Bacteria 2141
139 Ga0501033_0365356 3300049570 Bacteria 1009
140 Ga0501034_0150347 3300049571 Bacteria 2304
141 Ga0501036_0228033 3300049572 Bacteria 1563
142 Ga0501037_0188881 3300049573 Bacteria 1459
143 Ga0501038_0178753 3300049574 Bacteria 1713
144 Ga0501039_0067298 3300049575 Bacteria 2781
145 Ga0501039_0074408 3300049575 Bacteria 2640
146 Ga0501047_0061591 3300049581 Bacteria 3620
147 Ga0501047_0221863 3300049581 Bacteria 1746
148 Ga0501044_0025999 3300049823 Bacteria 6201
149 Ga0501044_0141060 3300049823 Bacteria 2398
150 Ga0501044_0395344 3300049823 Bacteria 1295
151 nmdc:mga05p37_71925_c1 3300050507 Bacteria 4255
152 Ga0500618_000495 3300053125 Bacteria 25258
153 Ga0500586_000087 3300053145 Bacteria 16005
154 2842917942 2842914999 Bacteria 4419378
155 2884342138 2884338543 Bacteria 4610696
156 2941471510 2941471342 Bacteria 5018624
157 Ga0495643_0160099
158 rootH2_10080223
159 Ga0055526_1000161
160 Ga0070670_100021858
161 Ga0068869_100035278
162 Ga0070682_100000456
163 Ga0070689_100000026
164 Ga0070669_100055827
165 Ga0070669_100306461
166 Ga0070673_100254753
167 Ga0070688_100000198
168 Ga0070714_100188061
169 Ga0070711_100033154
170 Ga0070700_100196150
171 Ga0070700_100236293
172 Ga0070694_100132973
173 Ga0070681_10022737
174 Ga0070698_100049208
175 Ga0070684_100127753
176 Ga0068853_100283028
177 Ga0070672_100323033
178 Ga0070686_100029362
179 Ga0070665_100003832
180 Ga0068855_100162116
181 Ga0070664_100059035
182 Ga0068857_100011542
183 Ga0068857_100139701
184 Ga0068862_100009100
185 Ga0070717_10159409
186 Ga0075428_100049733
187 Ga0105240_10632017
188 Ga0105240_10759174
189 Ga0114129_10052006
190 Ga0114129_10080612
191 Ga0114129_10096859
192 Ga0105243_10165811
193 Ga0105238_10102458
194 Ga0105238_10162126
195 Ga0105239_10076372
196 Ga0105246_10269930
197 Ga0157374_10019464
198 Ga0163162_10015107
199 Ga0157372_10098786
200 Ga0157372_10383547
201 Ga0157377_10000155
202 Ga0157379_10141301
203 Ga0209564_1000006
204 Ga0207654_10136084
205 Ga0207695_10433118
206 Ga0207663_10047871
207 Ga0207662_10107303
208 Ga0207681_10232773
209 Ga0207694_10124042
210 Ga0207694_10139635
211 Ga0207650_10012900
212 Ga0207664_10233769
213 Ga0207670_10000021
214 Ga0207670_10058752
215 Ga0207651_10148913
216 Ga0207651_10360422
217 Ga0207708_10229825
218 Ga0207674_10162519
219 Ga0268265_10220737
220 Ga0265330_10014771
221 Ga0265339_10112217
222 Ga0265327_10004015
223 Ga0265316_10012396
224 Ga0307513_10074614
225 Ga0265314_10000867
226 Ga0265342_10004915
227 Ga0265342_10059576
228 Ga0307510_10000006
229 Ga0316582_0102754
230 Ga0395905_0003769
231 Ga0439434_0009434
232 Ga0453684_0002537
233 Ga0453684_0358615
234 Ga0495629_0113305
235 Ga0495638_0202207
236 Ga0495582_0027133
237 Ga0495664_0007940
238 Ga0495585_0038341
239 Ga0495594_0000883
240 Ga0495607_0000080
241 Ga0495583_0041161
242 Ga0495606_0052966
243 Ga0495606_0101932
244 Ga0495606_0126399
245 Ga0495606_0195134
246 Ga0495610_0079265
247 Ga0495616_0123957
248 Ga0495620_0033798
249 Ga0495642_0021250
250 Ga0495665_0001508
251 Ga0495640_0025234
252 Ga0495633_0066012
253 Ga0495667_0197778
254 Ga0495656_0048548
255 Ga0495634_0084598
256 Ga0495635_0023939
257 Ga0495661_0023380
258 Ga0495646_0035872
259 Ga0495613_0032285
260 Ga0495670_0001069
261 Ga0495670_0034157
262 Ga0495600_0024534
263 Ga0495660_0117155
264 Ga0495581_0003903
265 Ga0495604_0035246
266 Ga0495676_0043579
267 Ga0495683_0051987
268 Ga0495675_0093166
269 Ga0495686_0063069
270 Ga0495593_0015746
271 Ga0495614_0009430
272 Ga0496102_0064407
273 Ga0496106_0708021
274 Ga0496110_0309680
275 Ga0496114_0217515
276 Ga0496116_0096913
277 Ga0496116_0140451
278 Ga0496117_0000090
279 Ga0496117_0009567
280 Ga0496118_0000032
281 Ga0496118_0000914
282 Ga0496118_0005016
283 Ga0496119_0011056
284 Ga0496120_0036465
285 Ga0496120_0133480
286 Ga0496121_0081039
287 Ga0496122_0035717
288 Ga0496123_0036423
289 Ga0496124_0000343
290 Ga0496124_0000482
291 Ga0496125_0038662
292 Ga0496126_0001814
293 Ga0501031_0060277
294 Ga0501033_0097977
295 Ga0501033_0365356
296 Ga0501034_0150347
297 Ga0501036_0228033
298 Ga0501037_0188881
299 Ga0501038_0178753
300 Ga0501039_0067298
301 Ga0501039_0074408
302 Ga0501047_0061591
303 Ga0501047_0221863
304 Ga0501044_0025999
305 Ga0501044_0141060
306 Ga0501044_0395344
307 nmdc:mga05p37_71925_c1
308 Ga0500618_000495
309 Ga0500586_000087
310 2842917942
311 2884342138
312 2941471510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20434

BD-FAE

BD-FAE

106

249

0.83

PF00326

Peptidase_S9

Prolyl oligopeptidase family

179

339

0.79

PF01738

DLH

Dienelactone hydrolase family

108

329

0.77

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

120

264

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8005 81 302
5aob-assembly1.cif.gz_A the structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound 0.7975 78 310
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7894 80 303
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.7878 25 307
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.7822 25 307
ID Description Score Start End Superfamily
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.826 81 302 3.40.50.1820
af_P96402_114_379_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8164 79 287 3.40.50.1820
af_M0R8J8_18_315_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7959 81 187 3.40.50.1820
5aobA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7946 78 310 3.40.50.1820
4q3kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7743 54 304 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A645DYG3-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.993 233 309
AF-A0A2V9MTU8-F1-model_v4 Xylanase 0.9832 141 306 GO:0016798
GO:0045493
AF-A0A2W0BBC7-F1-model_v4 Xylanase 0.9801 206 310 GO:0006508
GO:0008236
GO:0016798
GO:0045493
AF-A0A7V4PBV4-F1-model_v4 Alpha/beta hydrolase 0.9751 150 310 GO:0006508
GO:0008236
AF-A0A2D5S8J5-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9703 212 310

Map