F225336

General Info

Members Datasets Scaffolds Average Seq Length
156 111 312 286

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0336984|Ga0395900_0336984_47_1048
Length 333
Sequence MNRHNNRHAGKTKTESEQEPMQTKQSVTNSNNHQPSTACREKHAAMKLPIRSTIIAAFGLLSMLLPVSQTAHAQRIPPNLRREFVAPVVFQAAGPTRESIQSTVDAFRNGTAGLGDPNNLNNPGPLQNGRREINWDGGGNNFTTDTPVTPFNVFLNTRGSQFTTPGIGLSQAPTAGGPQGGLAVLFGNPTYGTIFRTFSDFRLFTPVGSNVTEALFFVPGTNGTVPATVRGFGAVFTDVDQPDGSGPGGKRGNRHASTLIEYFDQDGRLLFSSFVPASPGDGGLSFFGIVFDDARVASVRIETGDVAPGPNDDRRHDIVVMDDFIYGEPQLVK

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
100 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 26.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0336984 3300037418 Bacteria 1485
2 Ga0070690_100146384 3300005330 Unclassified 1608
3 Ga0070682_100337383 3300005337 Unclassified 1119
4 Ga0070689_100103478 3300005340 Bacteria 2257
5 Ga0070689_100234892 3300005340 Bacteria 1508
6 Ga0070692_10060315 3300005345 Bacteria 1997
7 Ga0070671_100068419 3300005355 Bacteria 2962
8 Ga0070711_100199255 3300005439 Bacteria 1544
9 Ga0070663_100297740 3300005455 Bacteria 1290
10 Ga0070681_10000469 3300005458 Bacteria 32902
11 Ga0070706_100033997 3300005467 Bacteria 4706
12 Ga0070707_100403293 3300005468 Bacteria 1327
13 Ga0070707_100421062 3300005468 Bacteria 1296
14 Ga0070698_100134574 3300005471 Bacteria 2426
15 Ga0070679_100014141 3300005530 Bacteria 7655
16 Ga0070697_100003997 3300005536 Bacteria 11306
17 Ga0070697_100046584 3300005536 Unclassified 3515
18 Ga0070697_100466182 3300005536 Unclassified 1101
19 Ga0068853_100016911 3300005539 Bacteria 6011
20 Ga0070672_100638569 3300005543 Bacteria 929
21 Ga0070695_100051178 3300005545 Unclassified 2649
22 Ga0070704_100064735 3300005549 Bacteria 2629
23 Ga0070704_100127229 3300005549 Bacteria 1968
24 Ga0070664_100420332 3300005564 Unclassified 1224
25 Ga0068857_100003433 3300005577 Bacteria 13224
26 Ga0068864_100006524 3300005618 Bacteria 9559
27 Ga0068864_100487372 3300005618 Unclassified 1184
28 Ga0068861_100030137 3300005719 Unclassified 3974
29 Ga0068870_10148643 3300005840 Unclassified 1378
30 Ga0068860_100028548 3300005843 Bacteria 5372
31 Ga0068862_100089202 3300005844 Unclassified 2683
32 Ga0081455_10000410 3300005937 Bacteria 56308
33 Ga0081455_10116173 3300005937 Bacteria 2117
34 Ga0081455_10133080 3300005937 Unclassified 1941
35 Ga0081540_1000018 3300005983 Bacteria 164931
36 Ga0070716_100101139 3300006173 Bacteria 1767
37 Ga0070712_100171326 3300006175 Bacteria 1684
38 Ga0075428_100006270 3300006844 Bacteria 13222
39 Ga0075428_100023394 3300006844 Bacteria 6837
40 Ga0075428_100496835 3300006844 Unclassified 1305
41 Ga0075430_100011641 3300006846 Bacteria 7483
42 Ga0075430_100059628 3300006846 Bacteria 3208
43 Ga0075430_100130094 3300006846 Unclassified 2098
44 Ga0075431_100092121 3300006847 Bacteria 3128
45 Ga0075431_100099960 3300006847 Bacteria 2993
46 Ga0075431_100222662 3300006847 Bacteria 1924
47 Ga0075431_100331411 3300006847 Unclassified 1533
48 Ga0075431_100698875 3300006847 Unclassified 992
49 Ga0075433_10033549 3300006852 Unclassified 4402
50 Ga0075433_10047967 3300006852 Bacteria 3714
51 Ga0075434_100050864 3300006871 Bacteria 4116
52 Ga0075436_100001574 3300006914 Bacteria 15570
53 Ga0075435_100002302 3300007076 Bacteria 12625
54 Ga0105240_10052550 3300009093 Bacteria 5121
55 Ga0111539_10022392 3300009094 Bacteria 7766
56 Ga0111539_10038260 3300009094 Bacteria 5787
57 Ga0111539_10105878 3300009094 Unclassified 3299
58 Ga0105245_10442820 3300009098 Bacteria 1306
59 Ga0114129_10013825 3300009147 Bacteria 11499
60 Ga0114129_10019732 3300009147 Bacteria 9594
61 Ga0114129_10045394 3300009147 Bacteria 6177
62 Ga0114129_10183869 3300009147 Unclassified 2842
63 Ga0114129_10620285 3300009147 Bacteria 1399
64 Ga0114129_10866452 3300009147 Bacteria 1147
65 Ga0105243_10009532 3300009148 Bacteria 7393
66 Ga0105241_10035351 3300009174 Bacteria 3758
67 Ga0157378_10413505 3300013297 Bacteria 1332
68 Ga0157375_10162347 3300013308 Unclassified 2377
69 Ga0157375_10479601 3300013308 Bacteria 1409
70 Ga0157375_10558525 3300013308 Unclassified 1306
71 Ga0163163_10008429 3300014325 Bacteria 9159
72 Ga0163163_10122669 3300014325 Unclassified 2633
73 Ga0163163_10158318 3300014325 Bacteria 2310
74 Ga0157380_10002553 3300014326 Bacteria 12295
75 Ga0157379_10231938 3300014968 Bacteria 1673
76 Ga0163161_10283506 3300017792 Bacteria 1300
77 Ga0207707_10162050 3300025912 Bacteria 1955
78 Ga0207693_10276607 3300025915 Bacteria 1315
79 Ga0207660_10431591 3300025917 Bacteria 1064
80 Ga0207660_10434284 3300025917 Bacteria 1060
81 Ga0207652_10092053 3300025921 Bacteria 2667
82 Ga0207659_10410177 3300025926 Bacteria 1135
83 Ga0207644_10115860 3300025931 Bacteria 2033
84 Ga0207690_10006453 3300025932 Bacteria 6953
85 Ga0207709_10064829 3300025935 Bacteria 2295
86 Ga0207704_10262050 3300025938 Unclassified 1304
87 Ga0207665_10132474 3300025939 Bacteria 1771
88 Ga0207691_10563503 3300025940 Bacteria 965
89 Ga0207679_10008991 3300025945 Bacteria 6383
90 Ga0207679_10276789 3300025945 Unclassified 1437
91 Ga0207667_10686989 3300025949 Unclassified 1027
92 Ga0207639_10024320 3300026041 Bacteria 4383
93 Ga0207678_10317170 3300026067 Bacteria 1341
94 Ga0207708_10063159 3300026075 Unclassified 2829
95 Ga0207676_10299619 3300026095 Bacteria 1467
96 Ga0207674_10000113 3300026116 Bacteria 93918
97 Ga0207675_100070537 3300026118 Bacteria 3266
98 Ga0209967_1004147 3300027364 Bacteria 1918
99 Ga0209984_1002566 3300027424 Bacteria 2037
100 Ga0209968_1013493 3300027526 Bacteria 1282
101 Ga0209982_1001006 3300027552 Bacteria 3739
102 Ga0210002_1006596 3300027617 Bacteria 1752
103 Ga0209983_1006955 3300027665 Bacteria 2323
104 Ga0209971_1004519 3300027682 Bacteria 3301
105 Ga0209998_10003358 3300027717 Bacteria 3512
106 Ga0207428_10078672 3300027907 Unclassified 2580
107 Ga0268265_10089990 3300028380 Unclassified 2450
108 Ga0268264_10072095 3300028381 Bacteria 2929
109 Ga0307408_100021454 3300031548 Unclassified 4371
110 Ga0307408_100315652 3300031548 Unclassified 1315
111 Ga0307413_10111042 3300031824 Unclassified 1835
112 Ga0307409_100005248 3300031995 Bacteria 7425
113 Ga0307416_100007471 3300032002 Bacteria 6953
114 Ga0307416_100773611 3300032002 Unclassified 1054
115 Ga0307414_10022357 3300032004 Unclassified 3987
116 Ga0307414_10505452 3300032004 Bacteria 1070
117 Ga0307411_10003524 3300032005 Bacteria 7281
118 Ga0307415_100017613 3300032126 Unclassified 4287
119 Ga0373937_0132544 3300036401 Bacteria 2328
120 Ga0395899_0042524 3300037312 Bacteria 3392
121 Ga0395900_0006106 3300037418 Bacteria 12563
122 Ga0395901_0424030 3300038443 Bacteria 1364
123 Ga0395901_0760283 3300038443 Bacteria 961
124 Ga0451577_0074104 3300042876 Unclassified 3037
125 Ga0453684_0094166 3300044712 Bacteria 3686
126 Ga0451576_0105959 3300045051 Bacteria 2925
127 Ga0451576_0400963 3300045051 Bacteria 1438
128 Ga0495629_0027161 3300046459 Bacteria 4066
129 Ga0495594_0025234 3300046499 Bacteria 3195
130 Ga0495581_0176655 3300047315 Bacteria 1248
131 Ga0501317_003998 3300049533 Bacteria 1508
132 Ga0501072_0018079 3300049588 Bacteria 5421
133 Ga0501075_0487480 3300049591 Unclassified 940
134 Ga0501076_0381267 3300049592 Bacteria 1159
135 Ga0501202_003961 3300049652 Bacteria 2566
136 Ga0501209_007100 3300049656 Unclassified 2129
137 Ga0501079_0305617 3300049741 Unclassified 1244
138 nmdc:mga05p37_20377_c1 3300050507 Bacteria 8022
139 nmdc:mga05p37_88901_c1 3300050507 Unclassified 3807
140 nmdc:mga05p37_8985_c1 3300050507 Bacteria 8077
141 nmdc:mga05p37_976760_c1 3300050507 Bacteria 903
142 nmdc:mga0qj67_35373_c1 3300050509 Unclassified 3904
143 nmdc:mga0qj67_95573_c1 3300050509 Bacteria 2392
144 nmdc:mga06r32_291004_c1 3300050510 Unclassified 1620
145 nmdc:mga06r32_335777_c1 3300050510 Bacteria 1496
146 nmdc:mga06r32_645912_c1 3300050510 Unclassified 1026
147 nmdc:mga06r32_686266_c1 3300050510 Unclassified 990
148 nmdc:mga08y16_12782_c1 3300050511 Bacteria 8834
149 nmdc:mga08y16_39266_c1 3300050511 Bacteria 4967
150 nmdc:mga0rr50_6214_c1 3300050513 Bacteria 7241
151 nmdc:mga08x19_44362_c1 3300050514 Bacteria 2839
152 nmdc:mga0a205_22342_c1 3300050515 Bacteria 5990
153 nmdc:mga0a205_68141_c2 3300050515 Bacteria 2782
154 Ga0495601_0320083 3300053077 Bacteria 1010
155 Ga0501082_0108256 3300060353 Bacteria 2405
156 Ga0530510_0070432 3300061734 Bacteria 2538
157 Ga0395900_0336984
158 Ga0070690_100146384
159 Ga0070682_100337383
160 Ga0070689_100103478
161 Ga0070689_100234892
162 Ga0070692_10060315
163 Ga0070671_100068419
164 Ga0070711_100199255
165 Ga0070663_100297740
166 Ga0070681_10000469
167 Ga0070706_100033997
168 Ga0070707_100403293
169 Ga0070707_100421062
170 Ga0070698_100134574
171 Ga0070679_100014141
172 Ga0070697_100003997
173 Ga0070697_100046584
174 Ga0070697_100466182
175 Ga0068853_100016911
176 Ga0070672_100638569
177 Ga0070695_100051178
178 Ga0070704_100064735
179 Ga0070704_100127229
180 Ga0070664_100420332
181 Ga0068857_100003433
182 Ga0068864_100006524
183 Ga0068864_100487372
184 Ga0068861_100030137
185 Ga0068870_10148643
186 Ga0068860_100028548
187 Ga0068862_100089202
188 Ga0081455_10000410
189 Ga0081455_10116173
190 Ga0081455_10133080
191 Ga0081540_1000018
192 Ga0070716_100101139
193 Ga0070712_100171326
194 Ga0075428_100006270
195 Ga0075428_100023394
196 Ga0075428_100496835
197 Ga0075430_100011641
198 Ga0075430_100059628
199 Ga0075430_100130094
200 Ga0075431_100092121
201 Ga0075431_100099960
202 Ga0075431_100222662
203 Ga0075431_100331411
204 Ga0075431_100698875
205 Ga0075433_10033549
206 Ga0075433_10047967
207 Ga0075434_100050864
208 Ga0075436_100001574
209 Ga0075435_100002302
210 Ga0105240_10052550
211 Ga0111539_10022392
212 Ga0111539_10038260
213 Ga0111539_10105878
214 Ga0105245_10442820
215 Ga0114129_10013825
216 Ga0114129_10019732
217 Ga0114129_10045394
218 Ga0114129_10183869
219 Ga0114129_10620285
220 Ga0114129_10866452
221 Ga0105243_10009532
222 Ga0105241_10035351
223 Ga0157378_10413505
224 Ga0157375_10162347
225 Ga0157375_10479601
226 Ga0157375_10558525
227 Ga0163163_10008429
228 Ga0163163_10122669
229 Ga0163163_10158318
230 Ga0157380_10002553
231 Ga0157379_10231938
232 Ga0163161_10283506
233 Ga0207707_10162050
234 Ga0207693_10276607
235 Ga0207660_10431591
236 Ga0207660_10434284
237 Ga0207652_10092053
238 Ga0207659_10410177
239 Ga0207644_10115860
240 Ga0207690_10006453
241 Ga0207709_10064829
242 Ga0207704_10262050
243 Ga0207665_10132474
244 Ga0207691_10563503
245 Ga0207679_10008991
246 Ga0207679_10276789
247 Ga0207667_10686989
248 Ga0207639_10024320
249 Ga0207678_10317170
250 Ga0207708_10063159
251 Ga0207676_10299619
252 Ga0207674_10000113
253 Ga0207675_100070537
254 Ga0209967_1004147
255 Ga0209984_1002566
256 Ga0209968_1013493
257 Ga0209982_1001006
258 Ga0210002_1006596
259 Ga0209983_1006955
260 Ga0209971_1004519
261 Ga0209998_10003358
262 Ga0207428_10078672
263 Ga0268265_10089990
264 Ga0268264_10072095
265 Ga0307408_100021454
266 Ga0307408_100315652
267 Ga0307413_10111042
268 Ga0307409_100005248
269 Ga0307416_100007471
270 Ga0307416_100773611
271 Ga0307414_10022357
272 Ga0307414_10505452
273 Ga0307411_10003524
274 Ga0307415_100017613
275 Ga0373937_0132544
276 Ga0395899_0042524
277 Ga0395900_0006106
278 Ga0395901_0424030
279 Ga0395901_0760283
280 Ga0451577_0074104
281 Ga0453684_0094166
282 Ga0451576_0105959
283 Ga0451576_0400963
284 Ga0495629_0027161
285 Ga0495594_0025234
286 Ga0495581_0176655
287 Ga0501317_003998
288 Ga0501072_0018079
289 Ga0501075_0487480
290 Ga0501076_0381267
291 Ga0501202_003961
292 Ga0501209_007100
293 Ga0501079_0305617
294 nmdc:mga05p37_20377_c1
295 nmdc:mga05p37_88901_c1
296 nmdc:mga05p37_8985_c1
297 nmdc:mga05p37_976760_c1
298 nmdc:mga0qj67_35373_c1
299 nmdc:mga0qj67_95573_c1
300 nmdc:mga06r32_291004_c1
301 nmdc:mga06r32_335777_c1
302 nmdc:mga06r32_645912_c1
303 nmdc:mga06r32_686266_c1
304 nmdc:mga08y16_12782_c1
305 nmdc:mga08y16_39266_c1
306 nmdc:mga0rr50_6214_c1
307 nmdc:mga08x19_44362_c1
308 nmdc:mga0a205_22342_c1
309 nmdc:mga0a205_68141_c2
310 Ga0495601_0320083
311 Ga0501082_0108256
312 Ga0530510_0070432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yc2-assembly2.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.5575 105 273
6ia5-assembly1.cif.gz_E crystal structure analysis of bacillus subtilis 168 xepa 0.5503 173 274
1uxx-assembly1.cif.gz_X cbm6ct from clostridium thermocellum in complex with xylopentaose 0.5226 139 272
2yc2-assembly2.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.5212 105 273
8hcj-assembly2.cif.gz_F structure of gh43 family enzyme, xylan 1, 4 beta- xylosidase from pseudopedobacter saltans 0.5149 147 279
ID Description Score Start End Superfamily
3hrzA02 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.6923 198 222 2.60.40.1930
af_P78509_1066_1226_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5822 145 274 2.60.120.260
af_Q9H8K7_59_198_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5698 166 272 2.60.120.260
3a7qA04 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5678 147 273 2.60.120.260
af_Q94527_340_457_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5543 203 239 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V6N6H2-F1-model_v4 Uncharacterized protein 0.9623 134 279
AF-A0A7W8M7X2-F1-model_v4 PEP-CTERM protein-sorting domain-containing protein 0.8954 13 279 GO:0016020
AF-A0A838DCN5-F1-model_v4 DUF4397 domain-containing protein 0.8886 161 279
AF-A0A831WSI0-F1-model_v4 CHRD domain-containing protein 0.8858 35 278
AF-A0A2V7KAN2-F1-model_v4 Uncharacterized protein 0.8793 104 268

Map