F224989

General Info

Members Datasets Scaffolds Average Seq Length
156 112 312 157

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10861078|Ga0207695_108610781
Length 158
Sequence MQNKSEYMRKAIALARRNVLSNEGGPFGAVIVKDGEIIATISACAVTSKFDPTAHAEIVAIRMACQLLGDFSLKGCEIYTSCEPCPMCLAACYWARLDKIYYGCTAEDAAKIGFDDEFIYKEFKKKPESRKLPTIKLLNKEAQIGFKEWTKSTRKIAY

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
21 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
40 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
41 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
98 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
101 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
102 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
103 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
104 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
105 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
106 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
107 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
108 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
109 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
110 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
111 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
112 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 1.28
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10861078 3300025913 Unclassified 786
2 Ga0070658_10111599 3300005327 Bacteria 2266
3 Ga0070689_100052373 3300005340 Bacteria 3157
4 Ga0070668_101261686 3300005347 Bacteria 671
5 Ga0070671_100891293 3300005355 Bacteria 777
6 Ga0070713_100006589 3300005436 Bacteria 8069
7 Ga0070710_10118405 3300005437 Bacteria 1600
8 Ga0070711_100165803 3300005439 Bacteria 1679
9 Ga0070711_100436150 3300005439 Bacteria 1070
10 Ga0068856_100084709 3300005614 Bacteria 3149
11 Ga0068858_101088305 3300005842 Unclassified 785
12 Ga0070716_100005977 3300006173 Bacteria 5924
13 Ga0070712_100000257 3300006175 Bacteria 29642
14 Ga0105240_11068146 3300009093 Unclassified 860
15 Ga0111539_11325741 3300009094 Unclassified 835
16 Ga0114129_11980851 3300009147 Unclassified 705
17 Ga0105248_10136491 3300009177 Bacteria 2767
18 Ga0105238_10019947 3300009551 Bacteria 6824
19 Ga0105239_10000001 3300010375 Bacteria 617353
20 Ga0105239_10272395 3300010375 Bacteria 1904
21 Ga0157375_10000111 3300013308 Bacteria 79589
22 Ga0157377_10159851 3300014745 Bacteria 1400
23 Ga0157379_12203482 3300014968 Bacteria 547
24 Ga0209758_1000382 3300025297 Bacteria 76653
25 Ga0207692_10148046 3300025898 Bacteria 1342
26 Ga0207680_10030019 3300025903 Unclassified 3061
27 Ga0207699_10002015 3300025906 Bacteria 9593
28 Ga0207693_10000390 3300025915 Bacteria 40303
29 Ga0207663_10384578 3300025916 Bacteria 1070
30 Ga0207694_10050649 3300025924 Bacteria 3217
31 Ga0207700_10015865 3300025928 Bacteria 4985
32 Ga0207700_10141290 3300025928 Bacteria 1978
33 Ga0207644_10767826 3300025931 Bacteria 806
34 Ga0207670_10152214 3300025936 Bacteria 1718
35 Ga0207665_10030232 3300025939 Unclassified 3580
36 Ga0207711_10019866 3300025941 Bacteria 5598
37 Ga0207689_10857330 3300025942 Bacteria 767
38 Ga0207703_10931501 3300026035 Unclassified 832
39 Ga0207702_10253179 3300026078 Bacteria 1654
40 Ga0265337_1000127 3300028556 Bacteria 38567
41 Ga0265337_1000883 3300028556 Bacteria 15760
42 Ga0265337_1007327 3300028556 Bacteria 4136
43 Ga0265319_1000013 3300028563 Bacteria 180699
44 Ga0265319_1002593 3300028563 Bacteria 9743
45 Ga0265318_10131648 3300028577 Bacteria 919
46 Ga0265323_10000071 3300028653 Bacteria 56313
47 Ga0265323_10012357 3300028653 Bacteria 3425
48 Ga0265323_10022452 3300028653 Bacteria 2411
49 Ga0265322_10049079 3300028654 Bacteria 1199
50 Ga0265322_10096408 3300028654 Unclassified 841
51 Ga0265336_10004038 3300028666 Bacteria 5591
52 Ga0265336_10027888 3300028666 Unclassified 1766
53 Ga0265336_10073574 3300028666 Bacteria 1021
54 Ga0265338_10000016 3300028800 Bacteria 347424
55 Ga0265338_10000232 3300028800 Bacteria 103731
56 Ga0265338_10003151 3300028800 Bacteria 23534
57 Ga0265338_10006431 3300028800 Bacteria 14974
58 Ga0265338_10008400 3300028800 Bacteria 12544
59 Ga0265338_10013650 3300028800 Bacteria 9147
60 Ga0265338_10028721 3300028800 Bacteria 5539
61 Ga0265338_10046609 3300028800 Bacteria 3970
62 Ga0265338_10088208 3300028800 Bacteria 2575
63 Ga0265338_10195410 3300028800 Unclassified 1530
64 Ga0265338_10254657 3300028800 Bacteria 1293
65 Ga0265338_10412133 3300028800 Bacteria 962
66 Ga0265338_10865473 3300028800 Bacteria 617
67 Ga0265324_10008695 3300029957 Bacteria 4015
68 Ga0265324_10010745 3300029957 Bacteria 3514
69 Ga0265324_10047440 3300029957 Unclassified 1478
70 Ga0265324_10144156 3300029957 Unclassified 809
71 Ga0265332_10131767 3300031238 Bacteria 1049
72 Ga0265320_10002587 3300031240 Bacteria 12565
73 Ga0265320_10007114 3300031240 Bacteria 6977
74 Ga0265320_10074210 3300031240 Unclassified 1597
75 Ga0265325_10034747 3300031241 Bacteria 2680
76 Ga0265340_10002679 3300031247 Bacteria 10127
77 Ga0265340_10011786 3300031247 Bacteria 4638
78 Ga0265339_10221188 3300031249 Bacteria 926
79 Ga0265339_10271790 3300031249 Bacteria 815
80 Ga0265327_10002659 3300031251 Bacteria 18369
81 Ga0265316_10007560 3300031344 Bacteria 10225
82 Ga0265316_10090097 3300031344 Bacteria 2340
83 Ga0265316_10097757 3300031344 Bacteria 2234
84 Ga0265316_10271918 3300031344 Bacteria 1240
85 Ga0265316_11041383 3300031344 Bacteria 569
86 Ga0307513_10251027 3300031456 Unclassified 1566
87 Ga0307408_101549662 3300031548 Bacteria 628
88 Ga0265313_10001062 3300031595 Bacteria 26644
89 Ga0307508_10001003 3300031616 Bacteria 32817
90 Ga0265314_10094644 3300031711 Unclassified 1936
91 Ga0265314_10108810 3300031711 Bacteria 1765
92 Ga0265342_10162825 3300031712 Bacteria 1232
93 Ga0265342_10178923 3300031712 Bacteria 1163
94 Ga0265342_10654776 3300031712 Unclassified 527
95 Ga0316576_10227355 3300031727 Bacteria 1403
96 Ga0307407_10006829 3300031903 Bacteria 5115
97 Ga0307409_100109399 3300031995 Bacteria 2314
98 Ga0307416_101810807 3300032002 Bacteria 714
99 Ga0307411_10773597 3300032005 Bacteria 843
100 Ga0307415_100586442 3300032126 Bacteria 990
101 Ga0316583_10084459 3300032133 Bacteria 1109
102 Ga0373951_0012288 3300035091 Bacteria 1925
103 Ga0373923_0501828 3300035111 Unclassified 592
104 Ga0373927_0028318 3300035695 Bacteria 3654
105 Ga0373937_0390477 3300036401 Bacteria 1320
106 Ga0316584_0216079 3300036712 Bacteria 1410
107 Ga0373925_0365361 3300037068 Bacteria 1173
108 Ga0451804_0939616 3300041463 Bacteria 1010
109 Ga0451843_1603687 3300041509 Bacteria 632
110 Ga0451853_3215981 3300041512 Bacteria 646
111 Ga0450895_003706 3300042132 Bacteria 1188
112 Ga0451577_0000104 3300042876 Bacteria 186417
113 Ga0453684_0000364 3300044712 Bacteria 186418
114 Ga0453684_0497664 3300044712 Bacteria 1350
115 Ga0453684_0507662 3300044712 Bacteria 1334
116 Ga0453684_1571468 3300044712 Bacteria 676
117 Ga0466968_0068277 3300044735 Bacteria 1543
118 Ga0451576_0017278 3300045051 Bacteria 7937
119 Ga0451576_0018530 3300045051 Bacteria 7628
120 Ga0495603_0279123 3300046455 Bacteria 960
121 Ga0495638_0059599 3300046460 Bacteria 2363
122 Ga0495580_0056622 3300046472 Bacteria 2760
123 Ga0495630_0073908 3300046517 Bacteria 2567
124 Ga0495630_0161295 3300046517 Bacteria 1707
125 Ga0495630_0933337 3300046517 Bacteria 660
126 Ga0495666_0175144 3300046526 Bacteria 992
127 Ga0495597_0228595 3300046542 Bacteria 737
128 Ga0495667_0075871 3300046559 Bacteria 2187
129 Ga0495625_0035493 3300046660 Bacteria 3675
130 Ga0495646_0386325 3300046680 Unclassified 729
131 Ga0495624_0546538 3300046690 Bacteria 692
132 Ga0495624_0595383 3300046690 Unclassified 659
133 Ga0495670_0366797 3300046691 Bacteria 776
134 Ga0495649_0336825 3300046694 Bacteria 764
135 Ga0495674_0073342 3300047319 Bacteria 2951
136 Ga0495684_0001461 3300047471 Bacteria 18932
137 Ga0495686_0000690 3300047472 Bacteria 45605
138 Ga0496100_1311491 3300048903 Unclassified 571
139 Ga0496124_0025500 3300048927 Bacteria 5354
140 Ga0501040_0636934 3300049576 Bacteria 770
141 Ga0501238_014708 3300049671 Bacteria 1074
142 Ga0501257_006892 3300049686 Bacteria 2529
143 Ga0501079_0734451 3300049741 Bacteria 777
144 Ga0501241_002716 3300049758 Bacteria 3407
145 Ga0495601_0496013 3300053077 Bacteria 788
146 Ga0500644_0163906 3300053088 Bacteria 900
147 Ga0500583_0202418 3300053092 Bacteria 987
148 Ga0500562_000095 3300053108 Bacteria 35281
149 Ga0500645_017769 3300053730 Unclassified 2225
150 Ga0500661_014482 3300055283 Bacteria 1420
151 2852625250 2852623160 Bacteria 4376875
152 2882457760 2882456835 Bacteria 6863978
153 2884934263 2884933994 Bacteria 4535041
154 2910248263 2910245624 Bacteria 6935613
155 2911141359 2911138879 Bacteria 5811561
156 2929156029 2929154850 Bacteria 6753285
157 Ga0207695_10861078
158 Ga0070658_10111599
159 Ga0070689_100052373
160 Ga0070668_101261686
161 Ga0070671_100891293
162 Ga0070713_100006589
163 Ga0070710_10118405
164 Ga0070711_100165803
165 Ga0070711_100436150
166 Ga0068856_100084709
167 Ga0068858_101088305
168 Ga0070716_100005977
169 Ga0070712_100000257
170 Ga0105240_11068146
171 Ga0111539_11325741
172 Ga0114129_11980851
173 Ga0105248_10136491
174 Ga0105238_10019947
175 Ga0105239_10000001
176 Ga0105239_10272395
177 Ga0157375_10000111
178 Ga0157377_10159851
179 Ga0157379_12203482
180 Ga0209758_1000382
181 Ga0207692_10148046
182 Ga0207680_10030019
183 Ga0207699_10002015
184 Ga0207693_10000390
185 Ga0207663_10384578
186 Ga0207694_10050649
187 Ga0207700_10015865
188 Ga0207700_10141290
189 Ga0207644_10767826
190 Ga0207670_10152214
191 Ga0207665_10030232
192 Ga0207711_10019866
193 Ga0207689_10857330
194 Ga0207703_10931501
195 Ga0207702_10253179
196 Ga0265337_1000127
197 Ga0265337_1000883
198 Ga0265337_1007327
199 Ga0265319_1000013
200 Ga0265319_1002593
201 Ga0265318_10131648
202 Ga0265323_10000071
203 Ga0265323_10012357
204 Ga0265323_10022452
205 Ga0265322_10049079
206 Ga0265322_10096408
207 Ga0265336_10004038
208 Ga0265336_10027888
209 Ga0265336_10073574
210 Ga0265338_10000016
211 Ga0265338_10000232
212 Ga0265338_10003151
213 Ga0265338_10006431
214 Ga0265338_10008400
215 Ga0265338_10013650
216 Ga0265338_10028721
217 Ga0265338_10046609
218 Ga0265338_10088208
219 Ga0265338_10195410
220 Ga0265338_10254657
221 Ga0265338_10412133
222 Ga0265338_10865473
223 Ga0265324_10008695
224 Ga0265324_10010745
225 Ga0265324_10047440
226 Ga0265324_10144156
227 Ga0265332_10131767
228 Ga0265320_10002587
229 Ga0265320_10007114
230 Ga0265320_10074210
231 Ga0265325_10034747
232 Ga0265340_10002679
233 Ga0265340_10011786
234 Ga0265339_10221188
235 Ga0265339_10271790
236 Ga0265327_10002659
237 Ga0265316_10007560
238 Ga0265316_10090097
239 Ga0265316_10097757
240 Ga0265316_10271918
241 Ga0265316_11041383
242 Ga0307513_10251027
243 Ga0307408_101549662
244 Ga0265313_10001062
245 Ga0307508_10001003
246 Ga0265314_10094644
247 Ga0265314_10108810
248 Ga0265342_10162825
249 Ga0265342_10178923
250 Ga0265342_10654776
251 Ga0316576_10227355
252 Ga0307407_10006829
253 Ga0307409_100109399
254 Ga0307416_101810807
255 Ga0307411_10773597
256 Ga0307415_100586442
257 Ga0316583_10084459
258 Ga0373951_0012288
259 Ga0373923_0501828
260 Ga0373927_0028318
261 Ga0373937_0390477
262 Ga0316584_0216079
263 Ga0373925_0365361
264 Ga0451804_0939616
265 Ga0451843_1603687
266 Ga0451853_3215981
267 Ga0450895_003706
268 Ga0451577_0000104
269 Ga0453684_0000364
270 Ga0453684_0497664
271 Ga0453684_0507662
272 Ga0453684_1571468
273 Ga0466968_0068277
274 Ga0451576_0017278
275 Ga0451576_0018530
276 Ga0495603_0279123
277 Ga0495638_0059599
278 Ga0495580_0056622
279 Ga0495630_0073908
280 Ga0495630_0161295
281 Ga0495630_0933337
282 Ga0495666_0175144
283 Ga0495597_0228595
284 Ga0495667_0075871
285 Ga0495625_0035493
286 Ga0495646_0386325
287 Ga0495624_0546538
288 Ga0495624_0595383
289 Ga0495670_0366797
290 Ga0495649_0336825
291 Ga0495674_0073342
292 Ga0495684_0001461
293 Ga0495686_0000690
294 Ga0496100_1311491
295 Ga0496124_0025500
296 Ga0501040_0636934
297 Ga0501238_014708
298 Ga0501257_006892
299 Ga0501079_0734451
300 Ga0501241_002716
301 Ga0495601_0496013
302 Ga0500644_0163906
303 Ga0500583_0202418
304 Ga0500562_000095
305 Ga0500645_017769
306 Ga0500661_014482
307 2852625250
308 2882457760
309 2884934263
310 2910248263
311 2911141359
312 2929156029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

1

104

0.91

PF14437

MafB19-deam

MafB19-like deaminase

2

130

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nx8-assembly1.cif.gz_A-2 the crystal structure of the trna-specific adenosine deaminase from streptococcus pyogenes 0.96 4 103
5jfy-assembly1.cif.gz_B crystal structure of a plant cytidine deaminase 0.9596 4 101
5jfy-assembly2.cif.gz_D crystal structure of a plant cytidine deaminase 0.9575 4 99
2xbz-assembly1.cif.gz_A-2 multiple oligomeric forms of the pseudomonas aeruginosa rets sensor domain modulate accessibility to the ligand-binding site 0.9421 25 38
1tiy-assembly1.cif.gz_A x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 0.9394 1 155
ID Description Score Start End Superfamily
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9838 26 38 3.50.80.10
af_A0A0R4IDF5_228_326_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9621 25 38 2.60.40.10
af_F8W4Y0_130_228_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9606 25 38 2.60.40.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.96 4 103 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9593 2 109 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7X8VJ74-F1-model_v4 Nucleoside deaminase 0.9823 1 113 GO:0006152
GO:0008270
GO:0047974
AF-A0A522CDG0-F1-model_v4 Nucleoside deaminase 0.9786 3 155 GO:0006152
GO:0008270
GO:0047974
AF-A0A1T4KPL4-F1-model_v4 tRNA(Arg) A34 adenosine deaminase TadA 0.977 5 118 GO:0006152
GO:0047974
AF-A0A0F8C7G6-F1-model_v4 Guanine deaminase 0.9744 4 155 GO:0006152
GO:0008270
GO:0047974
AF-A0A5E6MDE4-F1-model_v4 dCMP deaminase (EC 3.5.4.12) 0.974 3 153 GO:0004132
GO:0006152
GO:0008270
GO:0047974

Map