F224700

General Info

Members Datasets Scaffolds Average Seq Length
156 127 312 223

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10222458|Ga0111539_102224582
Length 241
Sequence MTPEQWTTVDRYITDLFVPPDPALDTTLRASTAAGLPQINVAPNQGKLLQLLARLVDARNILELGTLGGYSTIWLARALPAGGRLITLEADPRHAEVARTNIAQAGLAAVVELRVGKALDTLPLLASEGVGPFDLIFIDADKPGYPDYLPWALKLSRRGTLILADNVIRKGAVADAHSPDASVHGVRRFNELLAAEPRVSATAIQTVGSKGYDGFALALVTTDPERGRSPSAAGGLEWSRE

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
36 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
49 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
59 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.49
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10222458 3300009094 Bacteria 2198
2 JGI24739J22299_10068198 3300001989 Bacteria 1111
3 Ga0006562J51391_1096753 3300003578 Bacteria 2130
4 JGI25405J52794_10024363 3300003911 Bacteria 1235
5 Ga0070658_10478791 3300005327 Bacteria 1074
6 Ga0070683_100021224 3300005329 Bacteria 5793
7 Ga0070706_100471632 3300005467 Bacteria 1168
8 Ga0070665_100159750 3300005548 Unclassified 2255
9 Ga0070665_100617012 3300005548 Bacteria 1098
10 Ga0068855_100213362 3300005563 Bacteria 2168
11 Ga0068864_101368015 3300005618 Bacteria 709
12 Ga0068861_100000272 3300005719 Bacteria 28940
13 Ga0068858_100000001 3300005842 Bacteria 417735
14 Ga0068862_100000038 3300005844 Bacteria 171544
15 Ga0081455_10000199 3300005937 Bacteria 76227
16 Ga0081540_1000554 3300005983 Bacteria 36225
17 Ga0075430_100311108 3300006846 Bacteria 1303
18 Ga0075433_10041154 3300006852 Bacteria 4002
19 Ga0075434_100004840 3300006871 Bacteria 12203
20 Ga0075434_100439211 3300006871 Bacteria 1326
21 Ga0075429_100153131 3300006880 Bacteria 2019
22 Ga0075436_100029349 3300006914 Bacteria 3783
23 Ga0097620_100000848 3300006931 Bacteria 31131
24 Ga0075435_100001461 3300007076 Bacteria 15188
25 Ga0105247_10005516 3300009101 Bacteria 7963
26 Ga0105248_10001012 3300009177 Bacteria 31032
27 Ga0105237_10115038 3300009545 Bacteria 2683
28 Ga0105249_10013511 3300009553 Bacteria 7211
29 Ga0105239_10003129 3300010375 Eukaryota 20544
30 Ga0157369_10306850 3300013105 Bacteria 1651
31 Ga0163162_10022487 3300013306 Bacteria 6213
32 Ga0163163_10012984 3300014325 Bacteria 7608
33 Ga0157379_10000010 3300014968 Bacteria 124601
34 Ga0157379_10412946 3300014968 Bacteria 1242
35 Ga0157376_10616845 3300014969 Unclassified 1081
36 Ga0213876_10037126 3300021384 Bacteria 2570
37 Ga0213875_10123565 3300021388 Bacteria 1209
38 Ga0209759_1015312 3300025256 Bacteria 1984
39 Ga0207710_10004295 3300025900 Bacteria 6239
40 Ga0207705_10461642 3300025909 Bacteria 985
41 Ga0207650_10709652 3300025925 Bacteria 850
42 Ga0207687_10599358 3300025927 Bacteria 928
43 Ga0207686_10000066 3300025934 Bacteria 95095
44 Ga0207711_10000844 3300025941 Bacteria 29618
45 Ga0207712_10030381 3300025961 Bacteria 3632
46 Ga0207703_10000007 3300026035 Bacteria 418220
47 Ga0207675_100007770 3300026118 Bacteria 10117
48 Ga0207675_100082600 3300026118 Bacteria 3013
49 Ga0268265_10000036 3300028380 Bacteria 203278
50 Ga0265334_10002578 3300028573 Bacteria 8456
51 Ga0265318_10022614 3300028577 Bacteria 2512
52 Ga0265323_10015685 3300028653 Bacteria 2975
53 Ga0265322_10000239 3300028654 Bacteria 23853
54 Ga0265338_10003153 3300028800 Bacteria 23533
55 Ga0265338_10007298 3300028800 Bacteria 13790
56 Ga0265338_10075217 3300028800 Bacteria 2867
57 Ga0265338_10402154 3300028800 Bacteria 976
58 Ga0265340_10006654 3300031247 Bacteria 6338
59 Ga0265340_10030954 3300031247 Bacteria 2679
60 Ga0265331_10103009 3300031250 Bacteria 1312
61 Ga0265327_10001931 3300031251 Bacteria 23950
62 Ga0265316_10043961 3300031344 Bacteria 3555
63 Ga0265316_10175045 3300031344 Bacteria 1600
64 Ga0307513_10040023 3300031456 Bacteria 5188
65 Ga0265314_10132339 3300031711 Bacteria 1554
66 Ga0265342_10014356 3300031712 Bacteria 5260
67 Ga0265342_10367182 3300031712 Bacteria 747
68 Ga0316212_1028280 3300033547 Bacteria 787
69 Ga0373953_0035414 3300035117 Bacteria 1962
70 Ga0373954_0012134 3300035118 Bacteria 3830
71 Ga0373956_0053939 3300035119 Bacteria 1810
72 Ga0373955_0019606 3300035172 Bacteria 3384
73 Ga0373955_0119875 3300035172 Bacteria 1529
74 Ga0373933_0060157 3300035724 Bacteria 2290
75 Ga0373933_0071922 3300035724 Bacteria 2106
76 Ga0373937_0004446 3300036401 Bacteria 11916
77 Ga0373925_0038621 3300037068 Bacteria 3530
78 Ga0436361_0664792 3300039447 Bacteria 1858
79 Ga0436363_0147968 3300039450 Bacteria 1463
80 Ga0451843_1698187 3300041509 Bacteria 757
81 Ga0451577_0416925 3300042876 Bacteria 1219
82 Ga0453684_0222890 3300044712 Bacteria 2183
83 Ga0466967_0543281 3300045976 Bacteria 1143
84 Ga0466967_1212875 3300045976 Bacteria 752
85 Ga0495592_0184425 3300046454 Bacteria 1419
86 Ga0495629_0012857 3300046459 Bacteria 6055
87 Ga0495629_0018280 3300046459 Bacteria 5020
88 Ga0495629_0049638 3300046459 Bacteria 2941
89 Ga0495653_0013800 3300046463 Bacteria 6583
90 Ga0495664_0033232 3300046477 Bacteria 3031
91 Ga0495618_0012056 3300046514 Bacteria 5245
92 Ga0495628_0014096 3300046516 Bacteria 6709
93 Ga0495630_0002063 3300046517 Bacteria 13963
94 Ga0495652_0003644 3300046529 Bacteria 15082
95 Ga0495665_0000089 3300046531 Bacteria 41241
96 Ga0495640_0041321 3300046533 Bacteria 3223
97 Ga0495586_0002777 3300046535 Bacteria 9459
98 Ga0495586_0032093 3300046535 Bacteria 2816
99 Ga0495622_0000069 3300046557 Bacteria 89759
100 Ga0495667_0007043 3300046559 Bacteria 7631
101 Ga0495667_0031554 3300046559 Bacteria 3556
102 Ga0495634_0041072 3300046642 Bacteria 3142
103 Ga0495634_0133526 3300046642 Bacteria 1581
104 Ga0495635_0005180 3300046663 Bacteria 9074
105 Ga0495635_0151287 3300046663 Bacteria 1580
106 Ga0495661_0021570 3300046665 Eukaryota 4198
107 Ga0495623_0000693 3300046679 Bacteria 22389
108 Ga0495646_0002189 3300046680 Bacteria 11902
109 Ga0495647_0012230 3300046681 Bacteria 2953
110 Ga0495613_0014651 3300046689 Bacteria 5818
111 Ga0495624_0004244 3300046690 Bacteria 10534
112 Ga0495600_0047508 3300046809 Bacteria 2800
113 Ga0495581_0076440 3300047315 Bacteria 1937
114 Ga0495604_0005478 3300047317 Bacteria 10065
115 Ga0495674_0010344 3300047319 Bacteria 8832
116 Ga0495680_0003605 3300047322 Bacteria 15155
117 Ga0495680_0011341 3300047322 Bacteria 7898
118 Ga0495593_0000639 3300047673 Bacteria 20100
119 Ga0495593_0073014 3300047673 Bacteria 1780
120 Ga0495602_0004661 3300048088 Bacteria 14315
121 Ga0496101_0217923 3300048904 Bacteria 1480
122 Ga0496102_0000021 3300048905 Bacteria 246920
123 Ga0496103_0000001 3300048906 Bacteria 643471
124 Ga0496105_0042049 3300048908 Bacteria 3768
125 Ga0496105_0127915 3300048908 Bacteria 2094
126 Ga0496106_0476660 3300048909 Bacteria 1003
127 Ga0496114_0798024 3300048917 Bacteria 823
128 Ga0496120_0015443 3300048923 Eukaryota 5036
129 Ga0496126_0026176 3300048929 Bacteria 5598
130 Ga0501033_0001908 3300049570 Bacteria 18135
131 Ga0501033_0075460 3300049570 Bacteria 2474
132 Ga0501034_0001296 3300049571 Bacteria 33823
133 Ga0501034_0295457 3300049571 Bacteria 1557
134 Ga0501036_0000081 3300049572 Bacteria 58719
135 Ga0501037_0472651 3300049573 Bacteria 853
136 Ga0501038_0164100 3300049574 Bacteria 1803
137 Ga0501038_0279591 3300049574 Bacteria 1314
138 Ga0501038_0300539 3300049574 Bacteria 1260
139 Ga0501039_0003033 3300049575 Bacteria 12562
140 Ga0501042_0020760 3300049578 Bacteria 4573
141 Ga0501043_0006903 3300049579 Bacteria 9060
142 Ga0501046_0037046 3300049580 Bacteria 3921
143 Ga0501047_0055032 3300049581 Bacteria 3848
144 Ga0501068_0165795 3300049584 Bacteria 1393
145 Ga0501070_0000218 3300049586 Bacteria 54494
146 Ga0501074_0000417 3300049590 Bacteria 25438
147 Ga0501080_0026433 3300049742 Bacteria 5393
148 Ga0501035_0003094 3300049822 Bacteria 15981
149 Ga0501044_0021167 3300049823 Bacteria 6944
150 Ga0501044_0342392 3300049823 Bacteria 1416
151 Ga0501044_0587008 3300049823 Bacteria 1008
152 nmdc:mga0n895_102434_c1 3300050512 Bacteria 2874
153 nmdc:mga0n895_434208_c1 3300050512 Bacteria 1327
154 nmdc:mga0rr50_5429_c1 3300050513 Bacteria 7602
155 nmdc:mga08x19_8025_c1 3300050514 Bacteria 6273
156 nmdc:mga0a205_18_c2 3300050515 Bacteria 96859
157 Ga0111539_10222458
158 JGI24739J22299_10068198
159 Ga0006562J51391_1096753
160 JGI25405J52794_10024363
161 Ga0070658_10478791
162 Ga0070683_100021224
163 Ga0070706_100471632
164 Ga0070665_100159750
165 Ga0070665_100617012
166 Ga0068855_100213362
167 Ga0068864_101368015
168 Ga0068861_100000272
169 Ga0068858_100000001
170 Ga0068862_100000038
171 Ga0081455_10000199
172 Ga0081540_1000554
173 Ga0075430_100311108
174 Ga0075433_10041154
175 Ga0075434_100004840
176 Ga0075434_100439211
177 Ga0075429_100153131
178 Ga0075436_100029349
179 Ga0097620_100000848
180 Ga0075435_100001461
181 Ga0105247_10005516
182 Ga0105248_10001012
183 Ga0105237_10115038
184 Ga0105249_10013511
185 Ga0105239_10003129
186 Ga0157369_10306850
187 Ga0163162_10022487
188 Ga0163163_10012984
189 Ga0157379_10000010
190 Ga0157379_10412946
191 Ga0157376_10616845
192 Ga0213876_10037126
193 Ga0213875_10123565
194 Ga0209759_1015312
195 Ga0207710_10004295
196 Ga0207705_10461642
197 Ga0207650_10709652
198 Ga0207687_10599358
199 Ga0207686_10000066
200 Ga0207711_10000844
201 Ga0207712_10030381
202 Ga0207703_10000007
203 Ga0207675_100007770
204 Ga0207675_100082600
205 Ga0268265_10000036
206 Ga0265334_10002578
207 Ga0265318_10022614
208 Ga0265323_10015685
209 Ga0265322_10000239
210 Ga0265338_10003153
211 Ga0265338_10007298
212 Ga0265338_10075217
213 Ga0265338_10402154
214 Ga0265340_10006654
215 Ga0265340_10030954
216 Ga0265331_10103009
217 Ga0265327_10001931
218 Ga0265316_10043961
219 Ga0265316_10175045
220 Ga0307513_10040023
221 Ga0265314_10132339
222 Ga0265342_10014356
223 Ga0265342_10367182
224 Ga0316212_1028280
225 Ga0373953_0035414
226 Ga0373954_0012134
227 Ga0373956_0053939
228 Ga0373955_0019606
229 Ga0373955_0119875
230 Ga0373933_0060157
231 Ga0373933_0071922
232 Ga0373937_0004446
233 Ga0373925_0038621
234 Ga0436361_0664792
235 Ga0436363_0147968
236 Ga0451843_1698187
237 Ga0451577_0416925
238 Ga0453684_0222890
239 Ga0466967_0543281
240 Ga0466967_1212875
241 Ga0495592_0184425
242 Ga0495629_0012857
243 Ga0495629_0018280
244 Ga0495629_0049638
245 Ga0495653_0013800
246 Ga0495664_0033232
247 Ga0495618_0012056
248 Ga0495628_0014096
249 Ga0495630_0002063
250 Ga0495652_0003644
251 Ga0495665_0000089
252 Ga0495640_0041321
253 Ga0495586_0002777
254 Ga0495586_0032093
255 Ga0495622_0000069
256 Ga0495667_0007043
257 Ga0495667_0031554
258 Ga0495634_0041072
259 Ga0495634_0133526
260 Ga0495635_0005180
261 Ga0495635_0151287
262 Ga0495661_0021570
263 Ga0495623_0000693
264 Ga0495646_0002189
265 Ga0495647_0012230
266 Ga0495613_0014651
267 Ga0495624_0004244
268 Ga0495600_0047508
269 Ga0495581_0076440
270 Ga0495604_0005478
271 Ga0495674_0010344
272 Ga0495680_0003605
273 Ga0495680_0011341
274 Ga0495593_0000639
275 Ga0495593_0073014
276 Ga0495602_0004661
277 Ga0496101_0217923
278 Ga0496102_0000021
279 Ga0496103_0000001
280 Ga0496105_0042049
281 Ga0496105_0127915
282 Ga0496106_0476660
283 Ga0496114_0798024
284 Ga0496120_0015443
285 Ga0496126_0026176
286 Ga0501033_0001908
287 Ga0501033_0075460
288 Ga0501034_0001296
289 Ga0501034_0295457
290 Ga0501036_0000081
291 Ga0501037_0472651
292 Ga0501038_0164100
293 Ga0501038_0279591
294 Ga0501038_0300539
295 Ga0501039_0003033
296 Ga0501042_0020760
297 Ga0501043_0006903
298 Ga0501046_0037046
299 Ga0501047_0055032
300 Ga0501068_0165795
301 Ga0501070_0000218
302 Ga0501074_0000417
303 Ga0501080_0026433
304 Ga0501035_0003094
305 Ga0501044_0021167
306 Ga0501044_0342392
307 Ga0501044_0587008
308 nmdc:mga0n895_102434_c1
309 nmdc:mga0n895_434208_c1
310 nmdc:mga0rr50_5429_c1
311 nmdc:mga08x19_8025_c1
312 nmdc:mga0a205_18_c2

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

20

219

0.92

PF13578

Methyltransf_24

Methyltransferase domain

62

167

0.89

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

17

171

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3duw-assembly1.cif.gz_B crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah 0.9848 11 223
3tfw-assembly1.cif.gz_B-2 crystal structure of a putative o-methyltransferase from klebsiella pneumoniae 0.9822 11 224
7cvv-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.9784 11 223
8c9t-assembly2.cif.gz_B catechol o-methyltransferase from streptomyces avermitilis 0.9733 11 224
6jcl-assembly1.cif.gz_A crystal structure of cofactor-bound rv0187 from mtb 0.9699 10 222
ID Description Score Start End Superfamily
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9464 2 222 3.40.50.150
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9379 2 222 3.40.50.150
af_A0A0R0K566_14_120_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9205 45 130 3.40.50.150
3dulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9145 12 223 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9104 14 222 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Y2KDW9-F1-model_v4 deleted 0.9891 11 222
AF-A0A6D0ENJ7-F1-model_v4 deleted 0.987 14 164
AF-A0A2T7STZ3-F1-model_v4 O-methyltransferase 0.9868 11 224 GO:0008171
GO:0008757
GO:0032259
AF-J4GJE9-F1-model_v4 O-methyltransferase domain-containing protein 0.9855 11 222 GO:0008171
GO:0008757
GO:0032259
AF-A0A7V8Y9J2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9843 11 158 GO:0008171
GO:0008757
GO:0032259

Map