F224419

General Info

Members Datasets Scaffolds Average Seq Length
156 109 156 217

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10002639|Ga0068866_100026399
Length 259
Sequence MCCAKGASVVRTITLTPRPRGVLAPPLCAVPGRDYNCLDRNWNMYPAGNLFITAPHGRLEAILKEPRVDPVRGVALVLHPHPLGGGTMHNKVVFRAAAALNDAGLTTLRVNFRGVGQSTGAHDEGYGERDDVRVGLDYLSENYPGQEITLCGFSFGARVGLEVGIDDDRVRRLISIGTPVDKYDFSFLEQCRKPILFVHGEHDEYGNVDRLRELVAKVKAPMQLEIIPGAGHFFDDQLNELKRAITEWVLAQLSSQDKQ

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
96 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
97 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.28
Rhizosphere 98.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000004 3300002074 Bacteria 262344
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 Ga0065704_10105022 3300005289 Bacteria 2097
4 Ga0065707_10006240 3300005295 Bacteria 4715
5 Ga0070690_100066171 3300005330 Bacteria 2338
6 Ga0070670_100000364 3300005331 Bacteria 37748
7 Ga0068869_100042650 3300005334 Bacteria 3253
8 Ga0070682_100001168 3300005337 Bacteria 14979
9 Ga0070689_100177814 3300005340 Bacteria 1727
10 Ga0070691_10253445 3300005341 Bacteria 945
11 Ga0070687_100370933 3300005343 Bacteria 930
12 Ga0070687_100482523 3300005343 Bacteria 831
13 Ga0070692_10224359 3300005345 Bacteria 1112
14 Ga0070669_100176000 3300005353 Bacteria 1671
15 Ga0070671_100071874 3300005355 Bacteria 2888
16 Ga0070701_10161002 3300005438 Bacteria 1300
17 Ga0070705_100267591 3300005440 Unclassified 1209
18 Ga0070694_100008029 3300005444 Bacteria 6448
19 Ga0070708_100372588 3300005445 Unclassified 1346
20 Ga0070662_100688193 3300005457 Unclassified 864
21 Ga0070681_10003907 3300005458 Bacteria 14046
22 Ga0068867_100328764 3300005459 Unclassified 1269
23 Ga0070706_100001642 3300005467 Bacteria 23286
24 Ga0070706_100004259 3300005467 Bacteria 13886
25 Ga0070706_100021271 3300005467 Bacteria 5975
26 Ga0070707_100044567 3300005468 Bacteria 4247
27 Ga0070707_100118127 3300005468 Unclassified 2574
28 Ga0070707_100648837 3300005468 Unclassified 1018
29 Ga0070698_100000949 3300005471 Bacteria 31698
30 Ga0070698_100003467 3300005471 Bacteria 17358
31 Ga0070698_100003819 3300005471 Bacteria 16550
32 Ga0070698_100025300 3300005471 Bacteria 6186
33 Ga0070698_100262758 3300005471 Bacteria 1658
34 Ga0070699_100014044 3300005518 Bacteria 6889
35 Ga0070699_100135359 3300005518 Bacteria 2174
36 Ga0070699_100196199 3300005518 Bacteria 1794
37 Ga0070679_100006401 3300005530 Bacteria 10967
38 Ga0070697_100009334 3300005536 Bacteria 7670
39 Ga0070697_100029764 3300005536 Bacteria 4381
40 Ga0070697_100038157 3300005536 Unclassified 3881
41 Ga0070695_100183562 3300005545 Unclassified 1484
42 Ga0070695_100297067 3300005545 Bacteria 1192
43 Ga0070695_100690863 3300005545 Bacteria 809
44 Ga0070693_100018083 3300005547 Unclassified 3676
45 Ga0070665_100146380 3300005548 Bacteria 2365
46 Ga0070704_100028104 3300005549 Bacteria 3738
47 Ga0070704_100123275 3300005549 Unclassified 1995
48 Ga0070704_100155215 3300005549 Bacteria 1804
49 Ga0070704_100239468 3300005549 Bacteria 1484
50 Ga0068855_100887225 3300005563 Unclassified 943
51 Ga0068859_100514474 3300005617 Bacteria 1292
52 Ga0068864_100438900 3300005618 Bacteria 1247
53 Ga0068866_10002639 3300005718 Bacteria 7413
54 Ga0068861_100003243 3300005719 Bacteria 10768
55 Ga0068858_100000076 3300005842 Bacteria 104002
56 Ga0068858_100027549 3300005842 Bacteria 5279
57 Ga0081539_10011906 3300005985 Bacteria 6794
58 Ga0070716_100000003 3300006173 Bacteria 312721
59 Ga0070716_100033347 3300006173 Unclassified 2816
60 Ga0075433_10036415 3300006852 Unclassified 4239
61 Ga0075433_10339664 3300006852 Unclassified 1327
62 Ga0075434_100602683 3300006871 Bacteria 1117
63 Ga0075434_101053374 3300006871 Unclassified 827
64 Ga0075436_100275172 3300006914 Bacteria 1203
65 Ga0097620_100514479 3300006931 Bacteria 1292
66 Ga0075435_100323518 3300007076 Bacteria 1320
67 Ga0099794_10004168 3300007265 Bacteria 5639
68 Ga0105240_10434281 3300009093 Unclassified 1473
69 Ga0105247_10000002 3300009101 Bacteria 724587
70 Ga0114129_10017476 3300009147 Bacteria 10212
71 Ga0114129_11000192 3300009147 Bacteria 1053
72 Ga0105243_10000095 3300009148 Bacteria 100826
73 Ga0105243_10281129 3300009148 Bacteria 1499
74 Ga0105241_10036188 3300009174 Unclassified 3715
75 Ga0105241_10123920 3300009174 Bacteria 2084
76 Ga0105242_10000998 3300009176 Bacteria 22189
77 Ga0105242_10019530 3300009176 Bacteria 5311
78 Ga0105237_10022608 3300009545 Bacteria 6450
79 Ga0105249_10421585 3300009553 Bacteria 1368
80 Ga0105239_10042720 3300010375 Bacteria 4967
81 Ga0157370_10019872 3300013104 Bacteria 6720
82 Ga0157369_10022825 3300013105 Bacteria 6977
83 Ga0157378_10000077 3300013297 Bacteria 89664
84 Ga0157378_10002572 3300013297 Bacteria 16143
85 Ga0157378_10014082 3300013297 Bacteria 7003
86 Ga0157378_10037819 3300013297 Bacteria 4276
87 Ga0157378_10230160 3300013297 Unclassified 1766
88 Ga0157378_10333263 3300013297 Bacteria 1477
89 Ga0163162_10251679 3300013306 Bacteria 1898
90 Ga0163162_10824123 3300013306 Bacteria 1044
91 Ga0157372_10069802 3300013307 Bacteria 3952
92 Ga0157372_10438161 3300013307 Bacteria 1523
93 Ga0157375_10006014 3300013308 Bacteria 10582
94 Ga0157380_10096681 3300014326 Bacteria 2449
95 Ga0157379_10254302 3300014968 Bacteria 1595
96 Ga0157379_10511423 3300014968 Unclassified 1114
97 Ga0207672_1000038 3300025223 Bacteria 17223
98 Ga0207642_10006084 3300025899 Unclassified 3989
99 Ga0207710_10000002 3300025900 Bacteria 1251998
100 Ga0207699_10216965 3300025906 Unclassified 1304
101 Ga0207684_10013323 3300025910 Bacteria 7113
102 Ga0207684_10030071 3300025910 Bacteria 4624
103 Ga0207684_10031366 3300025910 Bacteria 4521
104 Ga0207684_10359375 3300025910 Bacteria 1253
105 Ga0207654_10296134 3300025911 Bacteria 1099
106 Ga0207707_10002236 3300025912 Bacteria 17492
107 Ga0207695_10166458 3300025913 Unclassified 2132
108 Ga0207652_10051095 3300025921 Bacteria 3543
109 Ga0207646_10028940 3300025922 Bacteria 5040
110 Ga0207644_10007542 3300025931 Bacteria 7094
111 Ga0207706_10346780 3300025933 Unclassified 1291
112 Ga0207686_10000085 3300025934 Bacteria 78672
113 Ga0207686_10002367 3300025934 Bacteria 10306
114 Ga0207686_10284926 3300025934 Bacteria 1221
115 Ga0207709_10000834 3300025935 Bacteria 23651
116 Ga0207709_10544065 3300025935 Bacteria 912
117 Ga0207665_10000009 3300025939 Bacteria 162252
118 Ga0207665_10038046 3300025939 Unclassified 3202
119 Ga0207665_10143490 3300025939 Bacteria 1705
120 Ga0207711_10163835 3300025941 Unclassified 2014
121 Ga0207689_10008908 3300025942 Bacteria 8704
122 Ga0207667_10498255 3300025949 Unclassified 1236
123 Ga0207640_10171667 3300025981 Bacteria 1617
124 Ga0207703_10000097 3300026035 Bacteria 103983
125 Ga0207703_10049888 3300026035 Bacteria 3385
126 Ga0207648_10174188 3300026089 Unclassified 1902
127 Ga0207675_100002179 3300026118 Bacteria 19459
128 Ga0209588_1009518 3300027671 Unclassified 2907
129 Ga0268266_10217390 3300028379 Bacteria 1755
130 Ga0307405_10108017 3300031731 Bacteria 1879
131 Ga0307406_10056556 3300031901 Unclassified 2513
132 Ga0242420_020472 3300038996 Bacteria 1177
133 Ga0439439_0028237 3300041406 Bacteria 1420
134 Ga0439455_0024962 3300042012 Bacteria 1450
135 Ga0453683_0032767 3300044673 Bacteria 3276
136 Ga0453684_0128448 3300044712 Unclassified 3046
137 Ga0451576_0030491 3300045051 Bacteria 5763
138 Ga0451576_0908785 3300045051 Unclassified 924
139 Ga0495663_0000078 3300046525 Bacteria 44247
140 Ga0495598_0009621 3300046537 Bacteria 2292
141 Ga0495659_0177330 3300046664 Unclassified 867
142 Ga0495670_0239805 3300046691 Unclassified 965
143 Ga0495636_0058312 3300047318 Bacteria 1628
144 Ga0495672_0024613 3300047320 Bacteria 3874
145 Ga0496106_0006620 3300048909 Bacteria 8574
146 Ga0496107_0478761 3300048910 Bacteria 924
147 nmdc:mga05p37_195796_c1 3300050507 Bacteria 2451
148 nmdc:mga05p37_314119_c1 3300050507 Unclassified 1857
149 nmdc:mga0n895_491634_c1 3300050512 Unclassified 1237
150 nmdc:mga0rr50_131_c1 3300050513 Bacteria 40891
151 nmdc:mga0rr50_773428_c1 3300050513 Bacteria 819
152 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
153 nmdc:mga0a205_15438_c1 3300050515 Bacteria 7138
154 nmdc:mga0a205_411691_c1 3300050515 Bacteria 1215
155 Ga0495655_0017493 3300053083 Bacteria 1562
156 Ga0530510_0396626 3300061734 Bacteria 1040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100176000 Ga0070669_1001760001 202
2 3300009176 Ga0105242_10019530 Ga0105242_100195303 202
3 3300013306 Ga0163162_10251679 Ga0163162_102516791 202
4 3300025934 Ga0207686_10000085 Ga0207686_1000008520 202
5 3300005547 Ga0070693_100018083 Ga0070693_1000180832 206
6 3300014968 Ga0157379_10511423 Ga0157379_105114232 206
7 3300005545 Ga0070695_100690863 Ga0070695_1006908631 208
8 3300005549 Ga0070704_100028104 Ga0070704_1000281046 208
9 3300005549 Ga0070704_100239468 Ga0070704_1002394681 208
10 3300005345 Ga0070692_10224359 Ga0070692_102243591 209
11 3300031901 Ga0307406_10056556 Ga0307406_100565561 209
12 3300005330 Ga0070690_100066171 Ga0070690_1000661712 210
13 3300005337 Ga0070682_100001168 Ga0070682_1000011686 210
14 3300005341 Ga0070691_10253445 Ga0070691_102534452 210
15 3300005343 Ga0070687_100370933 Ga0070687_1003709332 210
16 3300005438 Ga0070701_10161002 Ga0070701_101610021 210
17 3300005471 Ga0070698_100000949 Ga0070698_10000094915 210
18 3300005471 Ga0070698_100003819 Ga0070698_10000381910 210
19 3300005518 Ga0070699_100196199 Ga0070699_1001961992 210
20 3300005536 Ga0070697_100038157 Ga0070697_1000381572 210
21 3300005548 Ga0070665_100146380 Ga0070665_1001463802 210
22 3300025939 Ga0207665_10143490 Ga0207665_101434902 210
23 3300028379 Ga0268266_10217390 Ga0268266_102173902 210
24 3300046525 Ga0495663_0000078 Ga0495663_0000078_9997_10632 210
25 3300046691 Ga0495670_0239805 Ga0495670_0239805_219_881 210
26 3300053083 Ga0495655_0017493 Ga0495655_0017493_153_785 210
27 3300005457 Ga0070662_100688193 Ga0070662_1006881931 211
28 3300005459 Ga0068867_100328764 Ga0068867_1003287642 211
29 3300005468 Ga0070707_100118127 Ga0070707_1001181272 211
30 3300005471 Ga0070698_100025300 Ga0070698_1000253004 211
31 3300005536 Ga0070697_100029764 Ga0070697_1000297642 211
32 3300005563 Ga0068855_100887225 Ga0068855_1008872252 211
33 3300005718 Ga0068866_10002639 Ga0068866_100026399 211
34 3300006173 Ga0070716_100000003 Ga0070716_100000003237 211
35 3300006914 Ga0075436_100275172 Ga0075436_1002751722 211
36 3300007265 Ga0099794_10004168 Ga0099794_100041684 211
37 3300009093 Ga0105240_10434281 Ga0105240_104342812 211
38 3300013297 Ga0157378_10002572 Ga0157378_100025722 211
39 3300013297 Ga0157378_10230160 Ga0157378_102301603 211
40 3300014326 Ga0157380_10096681 Ga0157380_100966812 211
41 3300025899 Ga0207642_10006084 Ga0207642_100060841 211
42 3300025910 Ga0207684_10359375 Ga0207684_103593753 211
43 3300025913 Ga0207695_10166458 Ga0207695_101664582 211
44 3300025933 Ga0207706_10346780 Ga0207706_103467801 211
45 3300025939 Ga0207665_10000009 Ga0207665_10000009118 211
46 3300025981 Ga0207640_10171667 Ga0207640_101716673 211
47 3300026089 Ga0207648_10174188 Ga0207648_101741882 211
48 3300027671 Ga0209588_1009518 Ga0209588_10095183 211
49 3300006852 Ga0075433_10036415 Ga0075433_100364153 212
50 3300006871 Ga0075434_101053374 Ga0075434_1010533741 212
51 3300009147 Ga0114129_10017476 Ga0114129_100174762 212
52 3300013307 Ga0157372_10438161 Ga0157372_104381613 212
53 3300050507 nmdc:mga05p37_314119_c1 nmdc:mga05p37_314119_c1_532_1203 212
54 3300050512 nmdc:mga0n895_491634_c1 nmdc:mga0n895_491634_c1_482_1120 212
55 3300050515 nmdc:mga0a205_15438_c1 nmdc:mga0a205_15438_c1_4067_4738 212
56 3300002074 JGI24748J21848_1000004 JGI24748J21848_1000004164 213
57 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001759 213
58 3300005289 Ga0065704_10105022 Ga0065704_101050223 213
59 3300005295 Ga0065707_10006240 Ga0065707_100062406 213
60 3300005331 Ga0070670_100000364 Ga0070670_10000036425 213
61 3300005334 Ga0068869_100042650 Ga0068869_1000426502 213
62 3300005340 Ga0070689_100177814 Ga0070689_1001778141 213
63 3300005343 Ga0070687_100482523 Ga0070687_1004825231 213
64 3300005355 Ga0070671_100071874 Ga0070671_1000718742 213
65 3300005440 Ga0070705_100267591 Ga0070705_1002675911 213
66 3300005444 Ga0070694_100008029 Ga0070694_1000080293 213
67 3300005445 Ga0070708_100372588 Ga0070708_1003725882 213
68 3300005458 Ga0070681_10003907 Ga0070681_1000390715 213
69 3300005467 Ga0070706_100001642 Ga0070706_1000016423 213
70 3300005467 Ga0070706_100004259 Ga0070706_10000425912 213
71 3300005467 Ga0070706_100021271 Ga0070706_1000212713 213
72 3300005468 Ga0070707_100044567 Ga0070707_1000445675 213
73 3300005468 Ga0070707_100648837 Ga0070707_1006488371 213
74 3300005471 Ga0070698_100003467 Ga0070698_10000346717 213
75 3300005471 Ga0070698_100262758 Ga0070698_1002627582 213
76 3300005518 Ga0070699_100014044 Ga0070699_1000140448 213
77 3300005518 Ga0070699_100135359 Ga0070699_1001353592 213
78 3300005530 Ga0070679_100006401 Ga0070679_1000064017 213
79 3300005536 Ga0070697_100009334 Ga0070697_10000933411 213
80 3300005545 Ga0070695_100183562 Ga0070695_1001835622 213
81 3300005545 Ga0070695_100297067 Ga0070695_1002970671 213
82 3300005549 Ga0070704_100123275 Ga0070704_1001232753 213
83 3300005549 Ga0070704_100155215 Ga0070704_1001552152 213
84 3300005617 Ga0068859_100514474 Ga0068859_1005144742 213
85 3300005618 Ga0068864_100438900 Ga0068864_1004389002 213
86 3300005719 Ga0068861_100003243 Ga0068861_1000032437 213
87 3300005842 Ga0068858_100000076 Ga0068858_10000007671 213
88 3300005842 Ga0068858_100027549 Ga0068858_1000275493 213
89 3300005985 Ga0081539_10011906 Ga0081539_100119067 213
90 3300006173 Ga0070716_100033347 Ga0070716_1000333472 213
91 3300006852 Ga0075433_10339664 Ga0075433_103396642 213
92 3300006871 Ga0075434_100602683 Ga0075434_1006026831 213
93 3300006931 Ga0097620_100514479 Ga0097620_1005144792 213
94 3300007076 Ga0075435_100323518 Ga0075435_1003235182 213
95 3300009101 Ga0105247_10000002 Ga0105247_10000002244 213
96 3300009147 Ga0114129_11000192 Ga0114129_110001921 213
97 3300009148 Ga0105243_10000095 Ga0105243_1000009535 213
98 3300009148 Ga0105243_10281129 Ga0105243_102811291 213
99 3300009174 Ga0105241_10036188 Ga0105241_100361886 213
100 3300009174 Ga0105241_10123920 Ga0105241_101239202 213
101 3300009176 Ga0105242_10000998 Ga0105242_1000099810 213
102 3300009545 Ga0105237_10022608 Ga0105237_100226082 213
103 3300009553 Ga0105249_10421585 Ga0105249_104215852 213
104 3300010375 Ga0105239_10042720 Ga0105239_100427204 213
105 3300013104 Ga0157370_10019872 Ga0157370_100198724 213
106 3300013105 Ga0157369_10022825 Ga0157369_100228257 213
107 3300013297 Ga0157378_10000077 Ga0157378_1000007769 213
108 3300013297 Ga0157378_10014082 Ga0157378_100140823 213
109 3300013297 Ga0157378_10037819 Ga0157378_100378193 213
110 3300013297 Ga0157378_10333263 Ga0157378_103332631 213
111 3300013306 Ga0163162_10824123 Ga0163162_108241231 213
112 3300013307 Ga0157372_10069802 Ga0157372_100698025 213
113 3300013308 Ga0157375_10006014 Ga0157375_100060145 213
114 3300014968 Ga0157379_10254302 Ga0157379_102543022 213
115 3300025223 Ga0207672_1000038 Ga0207672_10000388 213
116 3300025900 Ga0207710_10000002 Ga0207710_10000002244 213
117 3300025906 Ga0207699_10216965 Ga0207699_102169651 213
118 3300025910 Ga0207684_10013323 Ga0207684_100133237 213
119 3300025910 Ga0207684_10030071 Ga0207684_100300715 213
120 3300025910 Ga0207684_10031366 Ga0207684_100313664 213
121 3300025911 Ga0207654_10296134 Ga0207654_102961342 213
122 3300025912 Ga0207707_10002236 Ga0207707_100022362 213
123 3300025921 Ga0207652_10051095 Ga0207652_100510952 213
124 3300025922 Ga0207646_10028940 Ga0207646_100289405 213
125 3300025931 Ga0207644_10007542 Ga0207644_100075428 213
126 3300025934 Ga0207686_10002367 Ga0207686_100023676 213
127 3300025934 Ga0207686_10284926 Ga0207686_102849262 213
128 3300025935 Ga0207709_10000834 Ga0207709_100008346 213
129 3300025935 Ga0207709_10544065 Ga0207709_105440652 213
130 3300025939 Ga0207665_10038046 Ga0207665_100380462 213
131 3300025941 Ga0207711_10163835 Ga0207711_101638352 213
132 3300025942 Ga0207689_10008908 Ga0207689_100089084 213
133 3300025949 Ga0207667_10498255 Ga0207667_104982551 213
134 3300026035 Ga0207703_10000097 Ga0207703_1000009719 213
135 3300026035 Ga0207703_10049888 Ga0207703_100498882 213
136 3300026118 Ga0207675_100002179 Ga0207675_1000021798 213
137 3300031731 Ga0307405_10108017 Ga0307405_101080172 213
138 3300038996 Ga0242420_020472 Ga0242420_020472_30_704 213
139 3300041406 Ga0439439_0028237 Ga0439439_0028237_74_748 213
140 3300042012 Ga0439455_0024962 Ga0439455_0024962_705_1346 213
141 3300044673 Ga0453683_0032767 Ga0453683_0032767_1765_2454 213
142 3300044712 Ga0453684_0128448 Ga0453684_0128448_1119_1808 213
143 3300045051 Ga0451576_0030491 Ga0451576_0030491_2749_3438 213
144 3300045051 Ga0451576_0908785 Ga0451576_0908785_64_723 213
145 3300046537 Ga0495598_0009621 Ga0495598_0009621_1282_1929 213
146 3300046664 Ga0495659_0177330 Ga0495659_0177330_106_759 213
147 3300047318 Ga0495636_0058312 Ga0495636_0058312_534_1187 213
148 3300047320 Ga0495672_0024613 Ga0495672_0024613_724_1374 213
149 3300048909 Ga0496106_0006620 Ga0496106_0006620_3095_3772 213
150 3300048910 Ga0496107_0478761 Ga0496107_0478761_175_852 213
151 3300050507 nmdc:mga05p37_195796_c1 nmdc:mga05p37_195796_c1_1510_2151 213
152 3300050513 nmdc:mga0rr50_131_c1 nmdc:mga0rr50_131_c1_27445_28089 213
153 3300050513 nmdc:mga0rr50_773428_c1 nmdc:mga0rr50_773428_c1_57_698 213
154 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_643520_644164 213
155 3300050515 nmdc:mga0a205_411691_c1 nmdc:mga0a205_411691_c1_372_1025 213
156 3300061734 Ga0530510_0396626 Ga0530510_0396626_64_714 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

70

189

0.89

PF01738

DLH

Dienelactone hydrolase family

121

254

0.85

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

74

249

0.8

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

75

190

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.9164 7 207
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8956 1 206
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8791 1 206
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.875 7 207
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.8746 1 206
ID Description Score Start End Superfamily
2i3dA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9017 7 207 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8956 1 206 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8791 1 206 3.40.50.1820
2wtnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8762 7 207 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8746 1 206 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7V9GAA5-F1-model_v4 Alpha/beta fold hydrolase 0.9947 68 207 GO:0016787
AF-A0A2V8Q4R2-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9917 92 207
AF-A0A7V9UWX9-F1-model_v4 Dienelactone hydrolase family protein 0.9881 99 207 GO:0016787
AF-A0A2V8WZU6-F1-model_v4 Alpha/beta hydrolase 0.9853 47 210 GO:0016787
AF-A0A7W0N641-F1-model_v4 Alpha/beta fold hydrolase 0.9775 21 210 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.7 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map