F223994

General Info

Members Datasets Scaffolds Average Seq Length
156 112 312 377

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100081271|Ga0070670_1000812713
Length 406
Sequence MAIAIVSGALANKPFNGGNAWTRLSWVTGLKQMGFDVLFIEQIAEADCVDAAGATTPFENSVNLSYFCEIMEWAGLTRSSALICDDGNKVHGLSVSEIAEQSSKADLLFNLSGHLTLTPVCRAARCKVYYDDDPGFTQFWHHQGDAGARLCGHDFYFTLGANIGQPECPIPVGDIFWRHTRPPVVLTEWPVSPPRRFDRFTTVASWRGAFGPMQYQGRTYGQKAHEFRKFITLPHRTGQAFEIALQIHPGDHKDLEALQANHWSIIDPRLVSESPLTFRDYVATSGAEFSVAQGIYVDTQSGWFSDRTVRYLASGRPVLVQDTGFSRHLPTGEGLLKFQNLDEAIEGAAAIVQDYPRQCRAARQIAEEYFDSSGVIGRLLNEIGIPSSPDLSVARPRPNRSAMLGS

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
86 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
101 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
111 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
112 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0
Rhizoplane 9.62
Rhizosphere 85.26
Stem 0
Stem Tuber 0
Unclassified 18.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100081271 3300005331 Bacteria 2785
2 Ga0070683_100042416 3300005329 Bacteria 4190
3 Ga0070660_100007393 3300005339 Bacteria 7651
4 Ga0070689_100140505 3300005340 Unclassified 1942
5 Ga0070689_100300932 3300005340 Bacteria 1335
6 Ga0070668_100017005 3300005347 Bacteria 5441
7 Ga0070669_100006049 3300005353 Bacteria 8731
8 Ga0070675_100004192 3300005354 Bacteria 10955
9 Ga0070674_100007320 3300005356 Bacteria 6505
10 Ga0070688_100074533 3300005365 Unclassified 2180
11 Ga0070688_100109297 3300005365 Bacteria 1836
12 Ga0070659_100000018 3300005366 Bacteria 156724
13 Ga0070667_100330402 3300005367 Bacteria 1377
14 Ga0070714_100056100 3300005435 Bacteria 3369
15 Ga0070711_100080548 3300005439 Bacteria 2319
16 Ga0070705_100006145 3300005440 Bacteria 5879
17 Ga0070708_100003813 3300005445 Bacteria 11825
18 Ga0070707_100008405 3300005468 Bacteria 9586
19 Ga0070707_100344121 3300005468 Unclassified 1448
20 Ga0070698_100009925 3300005471 Bacteria 10178
21 Ga0070698_100100654 3300005471 Bacteria 2862
22 Ga0070698_100226645 3300005471 Bacteria 1802
23 Ga0068853_100157361 3300005539 Bacteria 2048
24 Ga0070665_100000524 3300005548 Bacteria 54647
25 Ga0070665_100048730 3300005548 Bacteria 4253
26 Ga0070704_100004510 3300005549 Bacteria 8043
27 Ga0068855_100072799 3300005563 Bacteria 3994
28 Ga0068859_100296343 3300005617 Bacteria 1710
29 Ga0068859_100314036 3300005617 Unclassified 1661
30 Ga0068861_100199572 3300005719 Bacteria 1678
31 Ga0068870_10007577 3300005840 Bacteria 4849
32 Ga0068863_100122437 3300005841 Bacteria 2481
33 Ga0068858_100021259 3300005842 Bacteria 6061
34 Ga0068860_100010216 3300005843 Bacteria 9290
35 Ga0068860_100033597 3300005843 Bacteria 4921
36 Ga0081455_10137504 3300005937 Unclassified 1901
37 Ga0081455_10225507 3300005937 Bacteria 1386
38 Ga0070717_10074633 3300006028 Bacteria 2835
39 Ga0075365_10000763 3300006038 Bacteria 13086
40 Ga0075364_10004089 3300006051 Bacteria 8369
41 Ga0070715_10000979 3300006163 Bacteria 7982
42 Ga0070712_100152539 3300006175 Bacteria 1775
43 Ga0097621_100099820 3300006237 Bacteria 2441
44 Ga0097621_100319875 3300006237 Bacteria 1374
45 Ga0075428_100043473 3300006844 Unclassified 4939
46 Ga0075430_100000178 3300006846 Bacteria 42237
47 Ga0075430_100237247 3300006846 Unclassified 1511
48 Ga0075431_100060996 3300006847 Bacteria 3892
49 Ga0075433_10005972 3300006852 Bacteria 9586
50 Ga0075433_10187250 3300006852 Bacteria 1841
51 Ga0075434_100001006 3300006871 Bacteria 22897
52 Ga0075429_100019341 3300006880 Bacteria 5898
53 Ga0075429_100091835 3300006880 Bacteria 2648
54 Ga0097620_100296332 3300006931 Bacteria 1710
55 Ga0097620_100314060 3300006931 Unclassified 1661
56 Ga0105240_10157640 3300009093 Bacteria 2698
57 Ga0105240_10197893 3300009093 Unclassified 2357
58 Ga0111539_10642854 3300009094 Unclassified 1235
59 Ga0105245_10025921 3300009098 Bacteria 5157
60 Ga0114129_10001960 3300009147 Bacteria 28155
61 Ga0114129_10036296 3300009147 Bacteria 6961
62 Ga0114129_10193016 3300009147 Unclassified 2764
63 Ga0114129_10236691 3300009147 Bacteria 2456
64 Ga0114129_10288020 3300009147 Bacteria 2193
65 Ga0105243_10051548 3300009148 Bacteria 3255
66 Ga0105248_10058236 3300009177 Bacteria 4338
67 Ga0105249_10040023 3300009553 Bacteria 4257
68 Ga0105249_10124147 3300009553 Bacteria 2457
69 Ga0105249_10246144 3300009553 Unclassified 1770
70 Ga0157374_10157546 3300013296 Unclassified 2211
71 Ga0157374_10233224 3300013296 Bacteria 1808
72 Ga0157374_10267541 3300013296 Bacteria 1685
73 Ga0157375_10076210 3300013308 Bacteria 3380
74 Ga0163163_10005506 3300014325 Bacteria 10961
75 Ga0163163_10061494 3300014325 Bacteria 3721
76 Ga0163163_10119463 3300014325 Unclassified 2669
77 Ga0157380_10046660 3300014326 Unclassified 3404
78 Ga0157379_10001084 3300014968 Bacteria 22207
79 Ga0157376_10078775 3300014969 Bacteria 2823
80 Ga0207643_10011290 3300025908 Bacteria 4825
81 Ga0207684_10072717 3300025910 Unclassified 2920
82 Ga0207654_10059530 3300025911 Bacteria 2228
83 Ga0207695_10070569 3300025913 Bacteria 3570
84 Ga0207695_10123872 3300025913 Bacteria 2550
85 Ga0207657_10014469 3300025919 Bacteria 7702
86 Ga0207681_10009170 3300025923 Bacteria 6044
87 Ga0207659_10000933 3300025926 Bacteria 17431
88 Ga0207659_10050124 3300025926 Unclassified 2964
89 Ga0207659_10052873 3300025926 Bacteria 2895
90 Ga0207687_10037411 3300025927 Bacteria 3311
91 Ga0207690_10000143 3300025932 Bacteria 57131
92 Ga0207670_10164695 3300025936 Unclassified 1658
93 Ga0207669_10003478 3300025937 Bacteria 6811
94 Ga0207667_10089048 3300025949 Bacteria 3191
95 Ga0207712_10041847 3300025961 Bacteria 3151
96 Ga0207668_10173997 3300025972 Bacteria 1691
97 Ga0207703_10014866 3300026035 Bacteria 6075
98 Ga0207639_10118253 3300026041 Bacteria 2173
99 Ga0207675_100180190 3300026118 Unclassified 2023
100 Ga0268266_10008842 3300028379 Bacteria 8918
101 Ga0268266_10034937 3300028379 Bacteria 4276
102 Ga0268264_10024037 3300028381 Bacteria 4972
103 Ga0373927_0016329 3300035695 Unclassified 4899
104 Ga0373947_0088487 3300035725 Bacteria 1928
105 Ga0373937_0022440 3300036401 Bacteria 5675
106 Ga0373925_0002452 3300037068 Bacteria 14854
107 Ga0395901_0329833 3300038443 Bacteria 1578
108 Ga0466963_0082367 3300044694 Bacteria 2181
109 Ga0453684_0019144 3300044712 Bacteria 10445
110 Ga0466968_0006487 3300044735 Bacteria 4412
111 Ga0466967_0034988 3300045976 Bacteria 4270
112 Ga0466967_0045026 3300045976 Bacteria 3832
113 Ga0466967_0115720 3300045976 Bacteria 2470
114 Ga0495630_0042946 3300046517 Unclassified 3376
115 Ga0495666_0033033 3300046526 Unclassified 2530
116 Ga0495599_0008194 3300046678 Bacteria 6350
117 Ga0495669_0088204 3300046684 Bacteria 1430
118 Ga0495636_0017670 3300047318 Unclassified 2856
119 Ga0496104_0007198 3300048907 Bacteria 9810
120 Ga0496104_0050725 3300048907 Bacteria 3915
121 Ga0496105_0024685 3300048908 Bacteria 4885
122 Ga0496107_0029350 3300048910 Bacteria 3912
123 Ga0496108_0000839 3300048911 Bacteria 23918
124 Ga0496108_0040638 3300048911 Unclassified 3879
125 Ga0496108_0051873 3300048911 Bacteria 3436
126 Ga0496109_0025241 3300048912 Bacteria 5293
127 Ga0496110_0008880 3300048913 Bacteria 8102
128 Ga0496111_0016864 3300048914 Bacteria 5040
129 Ga0496111_0206195 3300048914 Unclassified 1461
130 Ga0496113_0034355 3300048916 Bacteria 3700
131 Ga0496113_0036533 3300048916 Bacteria 3600
132 Ga0496114_0019301 3300048917 Bacteria 5523
133 Ga0496115_0020395 3300048918 Bacteria 5114
134 Ga0501031_0180833 3300049568 Bacteria 1378
135 Ga0501072_0044854 3300049588 Bacteria 3476
136 Ga0501072_0357486 3300049588 Unclassified 1159
137 nmdc:mga03683_5416_c1 3300050489 Bacteria 4308
138 nmdc:mga03n38_27026_c1 3300050490 Unclassified 2376
139 nmdc:mga0yw44_2382_c1 3300050492 Bacteria 7992
140 nmdc:mga05p37_173597_c1 3300050507 Bacteria 2627
141 nmdc:mga05p37_453454_c1 3300050507 Bacteria 1484
142 nmdc:mga05p37_8368_c1 3300050507 Bacteria 12232
143 nmdc:mga05p37_84867_c1 3300050507 Unclassified 3901
144 nmdc:mga09592_14347_c1 3300050508 Bacteria 6469
145 nmdc:mga09592_9704_c1 3300050508 Bacteria 7817
146 nmdc:mga0qj67_5609_c1 3300050509 Bacteria 9172
147 nmdc:mga0qj67_76998_c1 3300050509 Bacteria 2669
148 nmdc:mga08y16_265279_c1 3300050511 Bacteria 1773
149 nmdc:mga0n895_9198_c1 3300050512 Bacteria 8631
150 nmdc:mga0a205_261437_c1 3300050515 Bacteria 1608
151 nmdc:mga0a205_30061_c1 3300050515 Bacteria 5200
152 nmdc:mga0a205_9904_c1 3300050515 Bacteria 8740
153 Ga0495601_0204860 3300053077 Unclassified 1289
154 Ga0500555_001093 3300053103 Bacteria 9036
155 Ga0500645_000352 3300053730 Bacteria 32678
156 Ga0500599_006771 3300053736 Bacteria 1464
157 Ga0070670_100081271
158 Ga0070683_100042416
159 Ga0070660_100007393
160 Ga0070689_100140505
161 Ga0070689_100300932
162 Ga0070668_100017005
163 Ga0070669_100006049
164 Ga0070675_100004192
165 Ga0070674_100007320
166 Ga0070688_100074533
167 Ga0070688_100109297
168 Ga0070659_100000018
169 Ga0070667_100330402
170 Ga0070714_100056100
171 Ga0070711_100080548
172 Ga0070705_100006145
173 Ga0070708_100003813
174 Ga0070707_100008405
175 Ga0070707_100344121
176 Ga0070698_100009925
177 Ga0070698_100100654
178 Ga0070698_100226645
179 Ga0068853_100157361
180 Ga0070665_100000524
181 Ga0070665_100048730
182 Ga0070704_100004510
183 Ga0068855_100072799
184 Ga0068859_100296343
185 Ga0068859_100314036
186 Ga0068861_100199572
187 Ga0068870_10007577
188 Ga0068863_100122437
189 Ga0068858_100021259
190 Ga0068860_100010216
191 Ga0068860_100033597
192 Ga0081455_10137504
193 Ga0081455_10225507
194 Ga0070717_10074633
195 Ga0075365_10000763
196 Ga0075364_10004089
197 Ga0070715_10000979
198 Ga0070712_100152539
199 Ga0097621_100099820
200 Ga0097621_100319875
201 Ga0075428_100043473
202 Ga0075430_100000178
203 Ga0075430_100237247
204 Ga0075431_100060996
205 Ga0075433_10005972
206 Ga0075433_10187250
207 Ga0075434_100001006
208 Ga0075429_100019341
209 Ga0075429_100091835
210 Ga0097620_100296332
211 Ga0097620_100314060
212 Ga0105240_10157640
213 Ga0105240_10197893
214 Ga0111539_10642854
215 Ga0105245_10025921
216 Ga0114129_10001960
217 Ga0114129_10036296
218 Ga0114129_10193016
219 Ga0114129_10236691
220 Ga0114129_10288020
221 Ga0105243_10051548
222 Ga0105248_10058236
223 Ga0105249_10040023
224 Ga0105249_10124147
225 Ga0105249_10246144
226 Ga0157374_10157546
227 Ga0157374_10233224
228 Ga0157374_10267541
229 Ga0157375_10076210
230 Ga0163163_10005506
231 Ga0163163_10061494
232 Ga0163163_10119463
233 Ga0157380_10046660
234 Ga0157379_10001084
235 Ga0157376_10078775
236 Ga0207643_10011290
237 Ga0207684_10072717
238 Ga0207654_10059530
239 Ga0207695_10070569
240 Ga0207695_10123872
241 Ga0207657_10014469
242 Ga0207681_10009170
243 Ga0207659_10000933
244 Ga0207659_10050124
245 Ga0207659_10052873
246 Ga0207687_10037411
247 Ga0207690_10000143
248 Ga0207670_10164695
249 Ga0207669_10003478
250 Ga0207667_10089048
251 Ga0207712_10041847
252 Ga0207668_10173997
253 Ga0207703_10014866
254 Ga0207639_10118253
255 Ga0207675_100180190
256 Ga0268266_10008842
257 Ga0268266_10034937
258 Ga0268264_10024037
259 Ga0373927_0016329
260 Ga0373947_0088487
261 Ga0373937_0022440
262 Ga0373925_0002452
263 Ga0395901_0329833
264 Ga0466963_0082367
265 Ga0453684_0019144
266 Ga0466968_0006487
267 Ga0466967_0034988
268 Ga0466967_0045026
269 Ga0466967_0115720
270 Ga0495630_0042946
271 Ga0495666_0033033
272 Ga0495599_0008194
273 Ga0495669_0088204
274 Ga0495636_0017670
275 Ga0496104_0007198
276 Ga0496104_0050725
277 Ga0496105_0024685
278 Ga0496107_0029350
279 Ga0496108_0000839
280 Ga0496108_0040638
281 Ga0496108_0051873
282 Ga0496109_0025241
283 Ga0496110_0008880
284 Ga0496111_0016864
285 Ga0496111_0206195
286 Ga0496113_0034355
287 Ga0496113_0036533
288 Ga0496114_0019301
289 Ga0496115_0020395
290 Ga0501031_0180833
291 Ga0501072_0044854
292 Ga0501072_0357486
293 nmdc:mga03683_5416_c1
294 nmdc:mga03n38_27026_c1
295 nmdc:mga0yw44_2382_c1
296 nmdc:mga05p37_173597_c1
297 nmdc:mga05p37_453454_c1
298 nmdc:mga05p37_8368_c1
299 nmdc:mga05p37_84867_c1
300 nmdc:mga09592_14347_c1
301 nmdc:mga09592_9704_c1
302 nmdc:mga0qj67_5609_c1
303 nmdc:mga0qj67_76998_c1
304 nmdc:mga08y16_265279_c1
305 nmdc:mga0n895_9198_c1
306 nmdc:mga0a205_261437_c1
307 nmdc:mga0a205_30061_c1
308 nmdc:mga0a205_9904_c1
309 Ga0495601_0204860
310 Ga0500555_001093
311 Ga0500645_000352
312 Ga0500599_006771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zue-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii arginyl-trna synthetase complexed with trna(arg) and an atp analog (anp) 0.7257 2 44
8evx-assembly1.cif.gz_A ddla from pseudomonas aeruginosa pao1 in complex with adp and phosphorylated d-cycloserine 0.7013 1 40
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.6731 184 373
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.6551 184 373
6n1x-assembly1.cif.gz_A bsha from staphylococcus aureus complexed with udp and n-acetylglucosamine 0.6498 2 386
ID Description Score Start End Superfamily
af_Q9SSP6_536_651_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7217 282 372 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6934 205 370 3.40.50.2000
af_I1NAU6_540_672_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6904 204 352 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6878 204 369 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6875 201 366 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4Q3WTR2-F1-model_v4 deleted 0.9768 308 384
AF-A0A7J9YRF0-F1-model_v4 Glycosyltransferase family 1 protein 0.9764 2 388
AF-A0A843T0B2-F1-model_v4 Glycosyltransferase family 1 protein 0.9754 2 388
AF-A0A536DIN9-F1-model_v4 Glycosyltransferase family 1 protein 0.9736 1 387
AF-A0A536DIN9-F1-model_v4 Glycosyltransferase family 1 protein 0.9711 1 387

Map