F223963

General Info

Members Datasets Scaffolds Average Seq Length
156 81 312 68

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101061745|Ga0070683_1010617452
Length 71
Sequence MTVADVRTGAKHTGVDKPTHVKGIKQGNSRGNYEKQRGHNPDGTSTAERSTGVSPGSSQPIDPSMPNLSPG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
24 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
29 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
51 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
52 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
53 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
54 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
55 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
74 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
76 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
79 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
80 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
81 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.03
Metatranscriptomes 8.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.41
Rhizosphere 72.44
Stem 0
Stem Tuber 0
Unclassified 28.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101061745 3300005329 Unclassified 778
2 JGI25407J50210_10005818 3300003373 Bacteria 3047
3 Ga0070683_100004653 3300005329 Bacteria 11344
4 Ga0070682_100469212 3300005337 Bacteria 968
5 Ga0070671_101068676 3300005355 Bacteria 708
6 Ga0070714_101582171 3300005435 Bacteria 640
7 Ga0070711_100002076 3300005439 Bacteria 11312
8 Ga0070700_101700248 3300005441 Unclassified 541
9 Ga0070681_10694631 3300005458 Bacteria 933
10 Ga0070681_10976024 3300005458 Bacteria 767
11 Ga0070679_100062768 3300005530 Bacteria 3704
12 Ga0070684_100004024 3300005535 Bacteria 11122
13 Ga0070684_100757141 3300005535 Unclassified 907
14 Ga0070684_101987288 3300005535 Bacteria 549
15 Ga0070696_101228024 3300005546 Bacteria 634
16 Ga0070693_100520295 3300005547 Bacteria 847
17 Ga0068857_100509303 3300005577 Archaea 1130
18 Ga0068859_100430184 3300005617 Bacteria 1416
19 Ga0081538_10000444 3300005981 Bacteria 46550
20 Ga0081538_10000852 3300005981 Bacteria 32907
21 Ga0075434_101104764 3300006871 Bacteria 806
22 Ga0097620_100430181 3300006931 Bacteria 1416
23 Ga0105240_11207602 3300009093 Unclassified 801
24 Ga0157370_11625144 3300013104 Unclassified 580
25 Ga0157375_10469146 3300013308 Unclassified 1424
26 Ga0197907_10848673 3300020069 Bacteria 1466
27 Ga0197907_11205862 3300020069 Bacteria 6712
28 Ga0206356_10986493 3300020070 Bacteria 1506
29 Ga0206356_11301958 3300020070 Unclassified 1615
30 Ga0206355_1719722 3300020076 Unclassified 551
31 Ga0206352_10043354 3300020078 Unclassified 551
32 Ga0206352_11179297 3300020078 Unclassified 916
33 Ga0206350_10578633 3300020080 Unclassified 792
34 Ga0206354_10507915 3300020081 Bacteria 3033
35 Ga0206354_11229834 3300020081 Bacteria 665
36 Ga0206353_10182180 3300020082 Bacteria 1981
37 Ga0206353_10453905 3300020082 Bacteria 630
38 Ga0213873_10054959 3300021358 Bacteria 1064
39 Ga0213874_10007921 3300021377 Bacteria 2569
40 Ga0213874_10426259 3300021377 Unclassified 520
41 Ga0213876_10008263 3300021384 Bacteria 5632
42 Ga0213876_10008540 3300021384 Bacteria 5545
43 Ga0213876_10013705 3300021384 Bacteria 4297
44 Ga0213876_10031156 3300021384 Bacteria 2815
45 Ga0213876_10240326 3300021384 Unclassified 963
46 Ga0213876_10468302 3300021384 Bacteria 670
47 Ga0213875_10000126 3300021388 Bacteria 84171
48 Ga0213875_10128067 3300021388 Bacteria 1187
49 Ga0224712_10000878 3300022467 Bacteria 6439
50 Ga0224712_10280853 3300022467 Bacteria 775
51 Ga0207707_10195180 3300025912 Unclassified 1766
52 Ga0207663_10012113 3300025916 Bacteria 4652
53 Ga0207660_10026538 3300025917 Bacteria 3946
54 Ga0207660_11324225 3300025917 Bacteria 585
55 Ga0207652_10373289 3300025921 Bacteria 1287
56 Ga0207646_10602543 3300025922 Bacteria 986
57 Ga0207661_10012140 3300025944 Bacteria 6255
58 Ga0207661_11783442 3300025944 Unclassified 561
59 Ga0207702_12342165 3300026078 Bacteria 522
60 Ga0207675_100097390 3300026118 Bacteria 2770
61 Ga0207683_12054560 3300026121 Unclassified 520
62 Ga0307410_11321086 3300031852 Unclassified 631
63 Ga0307416_101027833 3300032002 Unclassified 928
64 Ga0307416_102150279 3300032002 Bacteria 660
65 Ga0395900_0613733 3300037418 Unclassified 1027
66 Ga0395898_0161682 3300037466 Bacteria 2142
67 Ga0395898_0342794 3300037466 Bacteria 1425
68 Ga0395905_0728099 3300037471 Bacteria 894
69 Ga0436364_0010779 3300037853 Bacteria 2236
70 Ga0436364_0072848 3300037853 Bacteria 133330
71 Ga0436364_0308234 3300037853 Bacteria 512
72 Ga0436364_0356387 3300037853 Unclassified 1401
73 Ga0436364_0473825 3300037853 Bacteria 1711
74 Ga0436364_0653009 3300037853 Unclassified 1760
75 Ga0436364_0781443 3300037853 Unclassified 700
76 Ga0436364_0939070 3300037853 Unclassified 959
77 Ga0395901_0276730 3300038443 Bacteria 1745
78 Ga0395901_0372738 3300038443 Bacteria 1470
79 Ga0436365_0058370 3300039437 Bacteria 6471
80 Ga0436365_0517249 3300039437 Unclassified 907
81 Ga0436365_0632989 3300039437 Unclassified 530
82 Ga0436365_1306482 3300039437 Bacteria 8681
83 Ga0436365_1556885 3300039437 Bacteria 12446
84 Ga0436365_1628902 3300039437 Bacteria 3795
85 Ga0436365_1719956 3300039437 Unclassified 618
86 Ga0436365_1771563 3300039437 Unclassified 740
87 Ga0436365_1786720 3300039437 Bacteria 1748
88 Ga0436363_0695185 3300039450 Unclassified 717
89 Ga0436363_0805644 3300039450 Bacteria 1159
90 Ga0436363_1096342 3300039450 Bacteria 55301
91 Ga0436362_0233729 3300039453 Bacteria 4037
92 Ga0436362_0712097 3300039453 Unclassified 535
93 Ga0436362_1111567 3300039453 Unclassified 2249
94 Ga0451802_1843275 3300041460 Bacteria 654
95 Ga0451845_0612276 3300041501 Bacteria 610
96 Ga0451847_0734765 3300041503 Bacteria 502
97 Ga0451853_1944749 3300041512 Unclassified 805
98 Ga0466965_0042838 3300044683 Bacteria 2234
99 Ga0466965_0179543 3300044683 Bacteria 1116
100 Ga0466965_0240532 3300044683 Bacteria 969
101 Ga0466966_0094322 3300044684 Unclassified 1855
102 Ga0466966_0713054 3300044684 Unclassified 604
103 Ga0466966_0728258 3300044684 Unclassified 598
104 Ga0466961_0131104 3300044693 Unclassified 1571
105 Ga0466961_0174730 3300044693 Unclassified 1335
106 Ga0466961_0317100 3300044693 Bacteria 951
107 Ga0466963_0002410 3300044694 Bacteria 10462
108 Ga0466963_0058051 3300044694 Bacteria 2579
109 Ga0466963_0698492 3300044694 Unclassified 716
110 Ga0466963_0938633 3300044694 Bacteria 609
111 Ga0466971_0125166 3300044719 Bacteria 1191
112 Ga0466968_0158528 3300044735 Bacteria 1043
113 Ga0466968_0161436 3300044735 Bacteria 1034
114 Ga0466968_0171076 3300044735 Bacteria 1007
115 Ga0466968_0475151 3300044735 Unclassified 620
116 Ga0466970_0385412 3300044765 Unclassified 798
117 Ga0466970_0426663 3300044765 Bacteria 758
118 Ga0466957_0007745 3300044842 Bacteria 6077
119 Ga0466957_0880703 3300044842 Bacteria 639
120 Ga0466959_0021937 3300045049 Bacteria 4716
121 Ga0466959_0032282 3300045049 Bacteria 3876
122 Ga0466959_0229681 3300045049 Unclassified 1285
123 Ga0466959_0326753 3300045049 Unclassified 1048
124 Ga0466959_0990186 3300045049 Bacteria 560
125 Ga0466958_0005471 3300045836 Bacteria 6843
126 Ga0466958_0012364 3300045836 Bacteria 4835
127 Ga0466958_0020612 3300045836 Bacteria 3847
128 Ga0466958_0074760 3300045836 Bacteria 2077
129 Ga0466958_0076766 3300045836 Bacteria 2051
130 Ga0466958_0095417 3300045836 Unclassified 1844
131 Ga0466958_0155250 3300045836 Bacteria 1444
132 Ga0466967_0013045 3300045976 Bacteria 6397
133 Ga0466967_0262017 3300045976 Bacteria 1654
134 Ga0466967_0540539 3300045976 Bacteria 1146
135 Ga0466967_0776451 3300045976 Unclassified 951
136 Ga0495620_0123644 3300046515 Bacteria 1018
137 Ga0496108_1064353 3300048911 Bacteria 689
138 Ga0496108_1717106 3300048911 Bacteria 516
139 Ga0496109_0504490 3300048912 Bacteria 1142
140 Ga0496109_0848973 3300048912 Bacteria 851
141 Ga0496110_1878222 3300048913 Unclassified 509
142 Ga0496111_0782200 3300048914 Bacteria 691
143 Ga0496112_0019829 3300048915 Bacteria 6361
144 Ga0496112_0056398 3300048915 Bacteria 3866
145 Ga0496113_0462566 3300048916 Bacteria 1019
146 Ga0501041_0601033 3300049577 Bacteria 702
147 Ga0501069_0025357 3300049585 Bacteria 3240
148 Ga0501070_0000112 3300049586 Bacteria 71632
149 Ga0501080_0144089 3300049742 Bacteria 2202
150 nmdc:mga08y16_882732_c1 3300050511 Bacteria 881
151 nmdc:mga0n895_971802_c1 3300050512 Bacteria 832
152 nmdc:mga08x19_826840_c1 3300050514 Bacteria 658
153 Ga0466962_0050235 3300061719 Bacteria 1993
154 Ga0466962_0135853 3300061719 Bacteria 1190
155 Ga0466962_0273464 3300061719 Unclassified 833
156 Ga0466962_0578965 3300061719 Bacteria 571
157 Ga0070683_101061745
158 JGI25407J50210_10005818
159 Ga0070683_100004653
160 Ga0070682_100469212
161 Ga0070671_101068676
162 Ga0070714_101582171
163 Ga0070711_100002076
164 Ga0070700_101700248
165 Ga0070681_10694631
166 Ga0070681_10976024
167 Ga0070679_100062768
168 Ga0070684_100004024
169 Ga0070684_100757141
170 Ga0070684_101987288
171 Ga0070696_101228024
172 Ga0070693_100520295
173 Ga0068857_100509303
174 Ga0068859_100430184
175 Ga0081538_10000444
176 Ga0081538_10000852
177 Ga0075434_101104764
178 Ga0097620_100430181
179 Ga0105240_11207602
180 Ga0157370_11625144
181 Ga0157375_10469146
182 Ga0197907_10848673
183 Ga0197907_11205862
184 Ga0206356_10986493
185 Ga0206356_11301958
186 Ga0206355_1719722
187 Ga0206352_10043354
188 Ga0206352_11179297
189 Ga0206350_10578633
190 Ga0206354_10507915
191 Ga0206354_11229834
192 Ga0206353_10182180
193 Ga0206353_10453905
194 Ga0213873_10054959
195 Ga0213874_10007921
196 Ga0213874_10426259
197 Ga0213876_10008263
198 Ga0213876_10008540
199 Ga0213876_10013705
200 Ga0213876_10031156
201 Ga0213876_10240326
202 Ga0213876_10468302
203 Ga0213875_10000126
204 Ga0213875_10128067
205 Ga0224712_10000878
206 Ga0224712_10280853
207 Ga0207707_10195180
208 Ga0207663_10012113
209 Ga0207660_10026538
210 Ga0207660_11324225
211 Ga0207652_10373289
212 Ga0207646_10602543
213 Ga0207661_10012140
214 Ga0207661_11783442
215 Ga0207702_12342165
216 Ga0207675_100097390
217 Ga0207683_12054560
218 Ga0307410_11321086
219 Ga0307416_101027833
220 Ga0307416_102150279
221 Ga0395900_0613733
222 Ga0395898_0161682
223 Ga0395898_0342794
224 Ga0395905_0728099
225 Ga0436364_0010779
226 Ga0436364_0072848
227 Ga0436364_0308234
228 Ga0436364_0356387
229 Ga0436364_0473825
230 Ga0436364_0653009
231 Ga0436364_0781443
232 Ga0436364_0939070
233 Ga0395901_0276730
234 Ga0395901_0372738
235 Ga0436365_0058370
236 Ga0436365_0517249
237 Ga0436365_0632989
238 Ga0436365_1306482
239 Ga0436365_1556885
240 Ga0436365_1628902
241 Ga0436365_1719956
242 Ga0436365_1771563
243 Ga0436365_1786720
244 Ga0436363_0695185
245 Ga0436363_0805644
246 Ga0436363_1096342
247 Ga0436362_0233729
248 Ga0436362_0712097
249 Ga0436362_1111567
250 Ga0451802_1843275
251 Ga0451845_0612276
252 Ga0451847_0734765
253 Ga0451853_1944749
254 Ga0466965_0042838
255 Ga0466965_0179543
256 Ga0466965_0240532
257 Ga0466966_0094322
258 Ga0466966_0713054
259 Ga0466966_0728258
260 Ga0466961_0131104
261 Ga0466961_0174730
262 Ga0466961_0317100
263 Ga0466963_0002410
264 Ga0466963_0058051
265 Ga0466963_0698492
266 Ga0466963_0938633
267 Ga0466971_0125166
268 Ga0466968_0158528
269 Ga0466968_0161436
270 Ga0466968_0171076
271 Ga0466968_0475151
272 Ga0466970_0385412
273 Ga0466970_0426663
274 Ga0466957_0007745
275 Ga0466957_0880703
276 Ga0466959_0021937
277 Ga0466959_0032282
278 Ga0466959_0229681
279 Ga0466959_0326753
280 Ga0466959_0990186
281 Ga0466958_0005471
282 Ga0466958_0012364
283 Ga0466958_0020612
284 Ga0466958_0074760
285 Ga0466958_0076766
286 Ga0466958_0095417
287 Ga0466958_0155250
288 Ga0466967_0013045
289 Ga0466967_0262017
290 Ga0466967_0540539
291 Ga0466967_0776451
292 Ga0495620_0123644
293 Ga0496108_1064353
294 Ga0496108_1717106
295 Ga0496109_0504490
296 Ga0496109_0848973
297 Ga0496110_1878222
298 Ga0496111_0782200
299 Ga0496112_0019829
300 Ga0496112_0056398
301 Ga0496113_0462566
302 Ga0501041_0601033
303 Ga0501069_0025357
304 Ga0501070_0000112
305 Ga0501080_0144089
306 nmdc:mga08y16_882732_c1
307 nmdc:mga0n895_971802_c1
308 nmdc:mga08x19_826840_c1
309 Ga0466962_0050235
310 Ga0466962_0135853
311 Ga0466962_0273464
312 Ga0466962_0578965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map