F223504

General Info

Members Datasets Scaffolds Average Seq Length
155 129 133 269

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221649|2644277529
Length 313
Sequence LPVHVEMRRAPVPAGQAGGRMEIPHPSGALMFSRSARTLSIIAASATLLALTACASGGAGSAESDAPASDYVTDGKLTVATGEPAYFPWVLDDAPESGEGFEAAVAYAVAEELGFAEDDVVWVRSTFDQAIAPGPKDFDINLQQFSITEERAQTVDFSSPYYETTQAVITVAGSPAEGAASIAELKDLLIGAQTGTTSFQAVESEIAPTRGAQAFNTNDDAKLALQNRTVDAIVVDLPTAFYLTGVELDGGSIIGQLPKTEGNTGDQFGLVLAKDSALTADVTAAVDALRENGTLDALADEWLATGASAPVLQ

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221649 Leifsonia sp. Root4 Isolate Unclassified
5 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
6 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
7 2808606372 Agromyces sp. 23-23 Isolate Unclassified
8 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
9 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
10 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
11 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
12 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
13 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
14 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
15 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
16 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
17 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
18 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
19 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
20 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
122 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
123 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
126 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
128 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
129 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.52
Metatranscriptomes 1.29
Isolates 14.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 23.87
Nodule 0
Rhizoplane 1.94
Rhizosphere 58.71
Stem 0
Stem Tuber 0
Unclassified 14.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000531 3300002772 Bacteria 18002
2 JGI25165J46597_1000002 3300003214 Bacteria 765387
3 Ga0055539_1000111 3300003752 Bacteria 90530
4 Ga0055533_1000001 3300003756 Bacteria 1863437
5 Ga0055525_1000200 3300003759 Bacteria 70185
6 Ga0055541_1002305 3300003841 Bacteria 3844
7 Ga0070668_100246737 3300005347 Bacteria 1481
8 Ga0070675_100256322 3300005354 Bacteria 1532
9 Ga0070671_100370012 3300005355 Bacteria 1224
10 Ga0070710_10014918 3300005437 Bacteria 3920
11 Ga0070700_100288161 3300005441 Bacteria 1193
12 Ga0070662_100362641 3300005457 Bacteria 1189
13 Ga0070672_100015216 3300005543 Bacteria 5472
14 Ga0070664_100472414 3300005564 Bacteria 1153
15 Ga0068857_100501945 3300005577 Bacteria 1139
16 Ga0068856_100115203 3300005614 Bacteria 2687
17 Ga0070702_100012583 3300005615 Bacteria 4244
18 Ga0068852_100008300 3300005616 Bacteria 7645
19 Ga0068864_100278071 3300005618 Bacteria 1562
20 Ga0068864_100441399 3300005618 Unclassified 1243
21 Ga0068870_10026240 3300005840 Bacteria 2903
22 Ga0068862_100135500 3300005844 Bacteria 2182
23 Ga0075365_10010161 3300006038 Bacteria 5465
24 Ga0075364_10009975 3300006051 Bacteria 5718
25 Ga0105240_10012730 3300009093 Bacteria 11593
26 Ga0105243_10021950 3300009148 Bacteria 4848
27 Ga0105241_10003010 3300009174 Bacteria 12597
28 Ga0105237_10090408 3300009545 Bacteria 3051
29 Ga0105238_10352366 3300009551 Bacteria 1461
30 Ga0105249_10093974 3300009553 Bacteria 2810
31 Ga0105030_100574 3300009987 Bacteria 3279
32 Ga0105239_10108583 3300010375 Bacteria 3074
33 Ga0157370_10106458 3300013104 Bacteria 2624
34 Ga0157375_11032970 3300013308 Bacteria 960
35 Ga0163163_10127974 3300014325 Bacteria 2578
36 Ga0163163_10626513 3300014325 Bacteria 1139
37 Ga0157380_10008064 3300014326 Bacteria 7503
38 Ga0209566_100026 3300025225 Bacteria 367457
39 Ga0209674_100001 3300025226 Bacteria 4013750
40 Ga0209563_100001 3300025230 Bacteria 4013775
41 Ga0207427_100034 3300025231 Bacteria 320342
42 Ga0209437_100591 3300025233 Bacteria 23035
43 Ga0209677_100001 3300025253 Bacteria 4013787
44 Ga0209148_1001042 3300025254 Bacteria 17185
45 Ga0209233_1000001 3300025261 Bacteria 2992747
46 Ga0209455_1024993 3300025272 Bacteria 1095
47 Ga0207692_10007124 3300025898 Bacteria 4570
48 Ga0207688_10064317 3300025901 Bacteria 2071
49 Ga0207643_10092864 3300025908 Bacteria 1761
50 Ga0207643_10132097 3300025908 Bacteria 1486
51 Ga0207654_10000003 3300025911 Bacteria 1030378
52 Ga0207695_10006175 3300025913 Bacteria 15616
53 Ga0207671_10073772 3300025914 Bacteria 2549
54 Ga0207694_10228023 3300025924 Bacteria 1521
55 Ga0207644_10040271 3300025931 Bacteria 3302
56 Ga0207706_10346161 3300025933 Bacteria 1292
57 Ga0207709_10218744 3300025935 Bacteria 1372
58 Ga0207704_10147399 3300025938 Bacteria 1656
59 Ga0207691_10025927 3300025940 Bacteria 5502
60 Ga0207641_10137834 3300026088 Bacteria 2198
61 Ga0207641_10355212 3300026088 Bacteria 1398
62 Ga0207698_10000191 3300026142 Bacteria 38143
63 Ga0268265_10156008 3300028380 Bacteria 1932
64 Ga0307515_10045366 3300028794 Bacteria 6756
65 Ga0307515_10102001 3300028794 Bacteria 3457
66 Ga0307515_10382778 3300028794 Bacteria 1039
67 Ga0307408_100445915 3300031548 Bacteria 1122
68 Ga0307514_10020787 3300031649 Bacteria 5354
69 Ga0316576_10006094 3300031727 Bacteria 7462
70 Ga0316576_10028419 3300031727 Bacteria 3942
71 Ga0316578_10010224 3300031728 Bacteria 4862
72 Ga0316578_10125892 3300031728 Bacteria 1541
73 Ga0307412_10579657 3300031911 Bacteria 947
74 Ga0307416_100163207 3300032002 Bacteria 2063
75 Ga0307416_100738851 3300032002 Bacteria 1076
76 Ga0307415_100296708 3300032126 Bacteria 1337
77 Ga0316585_10105107 3300032137 Bacteria 927
78 Ga0316593_10087689 3300032168 Bacteria 1093
79 Ga0316596_1003889 3300033541 Bacteria 3308
80 Ga0316584_0007184 3300036712 Bacteria 7593
81 Ga0316584_0031002 3300036712 Bacteria 3953
82 Ga0400483_235678 3300039062 Bacteria 6241
83 Ga0466970_0070450 3300044765 Bacteria 1880
84 Ga0495650_0001825 3300046471 Bacteria 19103
85 Ga0495686_0061572 3300047472 Bacteria 2330
86 Ga0496101_0342756 3300048904 Bacteria 1174
87 Ga0496113_0150572 3300048916 Bacteria 1835
88 Ga0496114_0094900 3300048917 Bacteria 2538
89 Ga0496118_0013875 3300048921 Bacteria 7583
90 Ga0496119_0009396 3300048922 Bacteria 8402
91 Ga0496120_0015167 3300048923 Bacteria 5097
92 Ga0496121_0013193 3300048924 Bacteria 8906
93 Ga0496122_0002343 3300048925 Bacteria 27312
94 Ga0496123_0006710 3300048926 Bacteria 11084
95 Ga0496124_0044417 3300048927 Bacteria 3813
96 Ga0496126_0027756 3300048929 Bacteria 5402
97 Ga0496126_0183026 3300048929 Bacteria 1779
98 Ga0501032_0156251 3300049569 Bacteria 1498
99 Ga0501034_0020022 3300049571 Bacteria 6834
100 Ga0501034_0028267 3300049571 Bacteria 5705
101 Ga0501034_0234669 3300049571 Bacteria 1782
102 Ga0501034_0274974 3300049571 Bacteria 1624
103 Ga0501034_0417062 3300049571 Bacteria 1264
104 Ga0501037_0114037 3300049573 Bacteria 1945
105 Ga0501043_0005323 3300049579 Bacteria 10403
106 Ga0501043_0193069 3300049579 Bacteria 1583
107 Ga0501046_0217585 3300049580 Bacteria 1416
108 Ga0501047_0131554 3300049581 Bacteria 2382
109 Ga0501069_0046810 3300049585 Bacteria 2400
110 Ga0501070_0000908 3300049586 Bacteria 26975
111 Ga0501073_0032134 3300049589 Bacteria 3743
112 Ga0501080_0000057 3300049742 Bacteria 72729
113 Ga0501083_0191380 3300049744 Bacteria 1335
114 nmdc:mga00v17_8330_c1 3300050491 Bacteria 5578
115 nmdc:mga0yw44_4761_c1 3300050492 Bacteria 5699
116 nmdc:mga0yw44_79014_c1 3300050492 Bacteria 2058
117 Ga0500651_0001061 3300053093 Bacteria 13564
118 Ga0500650_0060286 3300053098 Bacteria 1771
119 Ga0500593_021321 3300053117 Bacteria 2852
120 Ga0500559_0000363 3300053136 Bacteria 33690
121 Ga0500559_0000712 3300053136 Bacteria 21851
122 Ga0500568_0000028 3300053139 Bacteria 161589
123 Ga0500568_0026061 3300053139 Bacteria 2457
124 Ga0500573_0000264 3300053140 Bacteria 22026
125 Ga0500573_0003430 3300053140 Bacteria 8203
126 Ga0500573_0003883 3300053140 Bacteria 7799
127 Ga0500573_0006574 3300053140 Bacteria 6307
128 Ga0500573_0010341 3300053140 Bacteria 5206
129 Ga0500573_0027100 3300053140 Bacteria 3294
130 Ga0500573_0029864 3300053140 Bacteria 3143
131 Ga0500577_0062846 3300053142 Bacteria 1433
132 Ga0500577_0094303 3300053142 Bacteria 1214
133 Ga0500616_0000799 3300053153 Bacteria 36009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0191380 Ga0501083_0191380_90_932 231
2 3300049580 Ga0501046_0217585 Ga0501046_0217585_123_965 237
3 3300049571 Ga0501034_0234669 Ga0501034_0234669_831_1679 238
4 3300028794 Ga0307515_10102001 Ga0307515_101020013 240
5 3300049571 Ga0501034_0274974 Ga0501034_0274974_515_1357 240
6 3300049571 Ga0501034_0417062 Ga0501034_0417062_28_828 240
7 3300049581 Ga0501047_0131554 Ga0501047_0131554_649_1491 240
8 3300049585 Ga0501069_0046810 Ga0501069_0046810_294_1136 240
9 3300049586 Ga0501070_0000908 Ga0501070_0000908_18208_19050 240
10 3300049589 Ga0501073_0032134 Ga0501073_0032134_1262_2104 240
11 3300049742 Ga0501080_0000057 Ga0501080_0000057_14725_15567 240
12 iso_pu_bacteria 2966924647 2966925197 244
13 iso_pu_bacteria 2995726249 2995727659 245
14 iso_pu_bacteria 8055037949 8055038160 245
15 3300005441 Ga0070700_100288161 Ga0070700_1002881611 246
16 3300005457 Ga0070662_100362641 Ga0070662_1003626412 246
17 3300005564 Ga0070664_100472414 Ga0070664_1004724141 246
18 3300005840 Ga0068870_10026240 Ga0068870_100262403 246
19 3300014326 Ga0157380_10008064 Ga0157380_100080644 246
20 3300025908 Ga0207643_10092864 Ga0207643_100928642 246
21 3300048916 Ga0496113_0150572 Ga0496113_0150572_936_1775 246
22 3300009987 Ga0105030_100574 Ga0105030_1005743 247
23 iso_pu_bacteria 2721755702 2723642853 247
24 iso_pu_bacteria 2857720070 2857722315 247
25 iso_pu_bacteria 2928090899 2928091068 247
26 iso_pu_bacteria 2935409751 2935412978 247
27 iso_pu_bacteria 2984580707 2984582182 247
28 iso_pu_bacteria 8055034563 8055036371 247
29 3300031548 Ga0307408_100445915 Ga0307408_1004459151 248
30 3300031911 Ga0307412_10579657 Ga0307412_105796571 248
31 iso_pu_bacteria 2808606372 2808902843 248
32 iso_pu_bacteria 2852643534 2852645012 248
33 iso_pu_bacteria 2919443155 2919443418 248
34 3300005844 Ga0068862_100135500 Ga0068862_1001355002 249
35 3300025272 Ga0209455_1024993 Ga0209455_10249932 249
36 3300025901 Ga0207688_10064317 Ga0207688_100643173 249
37 3300025933 Ga0207706_10346161 Ga0207706_103461612 249
38 3300028380 Ga0268265_10156008 Ga0268265_101560082 249
39 3300032002 Ga0307416_100738851 Ga0307416_1007388512 249
40 iso_pu_bacteria 2857733635 2857736775 249
41 iso_pu_bacteria 2870622029 2870622944 249
42 3300005355 Ga0070671_100370012 Ga0070671_1003700122 250
43 3300005543 Ga0070672_100015216 Ga0070672_1000152165 250
44 3300005618 Ga0068864_100441399 Ga0068864_1004413991 250
45 3300014325 Ga0163163_10127974 Ga0163163_101279742 250
46 3300025931 Ga0207644_10040271 Ga0207644_100402711 250
47 3300025940 Ga0207691_10025927 Ga0207691_100259276 250
48 3300026088 Ga0207641_10137834 Ga0207641_101378341 250
49 3300031727 Ga0316576_10006094 Ga0316576_100060946 250
50 3300031727 Ga0316576_10028419 Ga0316576_100284193 250
51 3300031728 Ga0316578_10010224 Ga0316578_100102242 250
52 3300031728 Ga0316578_10125892 Ga0316578_101258922 250
53 3300032137 Ga0316585_10105107 Ga0316585_101051071 250
54 3300032168 Ga0316593_10087689 Ga0316593_100876891 250
55 3300033541 Ga0316596_1003889 Ga0316596_10038892 250
56 3300036712 Ga0316584_0007184 Ga0316584_0007184_3603_4469 250
57 3300036712 Ga0316584_0031002 Ga0316584_0031002_1711_2574 250
58 3300039062 Ga0400483_235678 Ga0400483_235678_1668_2495 250
59 3300053093 Ga0500651_0001061 Ga0500651_0001061_4955_5797 250
60 3300053140 Ga0500573_0027100 Ga0500573_0027100_421_1278 250
61 iso_pu_bacteria 2833709550 2833710121 250
62 iso_pu_bacteria 2857737099 2857739992 250
63 3300048921 Ga0496118_0013875 Ga0496118_0013875_63_905 251
64 3300048927 Ga0496124_0044417 Ga0496124_0044417_2737_3591 251
65 3300053140 Ga0500573_0010341 Ga0500573_0010341_2398_3240 251
66 3300005577 Ga0068857_100501945 Ga0068857_1005019452 252
67 3300005614 Ga0068856_100115203 Ga0068856_1001152034 252
68 3300005616 Ga0068852_100008300 Ga0068852_1000083008 252
69 3300009093 Ga0105240_10012730 Ga0105240_100127309 252
70 3300009174 Ga0105241_10003010 Ga0105241_100030102 252
71 3300009545 Ga0105237_10090408 Ga0105237_100904082 252
72 3300009551 Ga0105238_10352366 Ga0105238_103523662 252
73 3300010375 Ga0105239_10108583 Ga0105239_101085834 252
74 3300025908 Ga0207643_10132097 Ga0207643_101320971 252
75 3300025911 Ga0207654_10000003 Ga0207654_1000000344 252
76 3300025913 Ga0207695_10006175 Ga0207695_100061756 252
77 3300025914 Ga0207671_10073772 Ga0207671_100737723 252
78 3300025924 Ga0207694_10228023 Ga0207694_102280232 252
79 3300026142 Ga0207698_10000191 Ga0207698_1000019130 252
80 3300046471 Ga0495650_0001825 Ga0495650_0001825_79_921 252
81 3300048925 Ga0496122_0002343 Ga0496122_0002343_22863_23687 252
82 3300048926 Ga0496123_0006710 Ga0496123_0006710_5826_6650 252
83 3300048929 Ga0496126_0027756 Ga0496126_0027756_1680_2501 252
84 3300048929 Ga0496126_0183026 Ga0496126_0183026_630_1493 252
85 3300053117 Ga0500593_021321 Ga0500593_021321_1966_2802 252
86 3300053136 Ga0500559_0000363 Ga0500559_0000363_5172_6008 252
87 3300053140 Ga0500573_0003883 Ga0500573_0003883_590_1438 252
88 3300053140 Ga0500573_0029864 Ga0500573_0029864_649_1563 252
89 iso_pu_bacteria 2643221549 2643769566 252
90 3300003752 Ga0055539_1000111 Ga0055539_100011142 253
91 3300003756 Ga0055533_1000001 Ga0055533_1000001389 253
92 3300003759 Ga0055525_1000200 Ga0055525_100020045 253
93 3300003841 Ga0055541_1002305 Ga0055541_10023056 253
94 3300006038 Ga0075365_10010161 Ga0075365_100101614 253
95 3300006051 Ga0075364_10009975 Ga0075364_100099752 253
96 3300013104 Ga0157370_10106458 Ga0157370_101064582 253
97 3300025225 Ga0209566_100026 Ga0209566_100026334 253
98 3300025226 Ga0209674_100001 Ga0209674_100001390 253
99 3300025230 Ga0209563_100001 Ga0209563_100001390 253
100 3300025253 Ga0209677_100001 Ga0209677_100001390 253
101 3300025254 Ga0209148_1001042 Ga0209148_100104212 253
102 3300025938 Ga0207704_10147399 Ga0207704_101473992 253
103 3300050491 nmdc:mga00v17_8330_c1 nmdc:mga00v17_8330_c1_803_1648 253
104 3300050492 nmdc:mga0yw44_79014_c1 nmdc:mga0yw44_79014_c1_620_1465 253
105 3300053139 Ga0500568_0000028 Ga0500568_0000028_6482_7303 253
106 3300053142 Ga0500577_0062846 Ga0500577_0062846_539_1402 253
107 iso_pu_bacteria 2585428094 2587864799 253
108 3300005354 Ga0070675_100256322 Ga0070675_1002563222 254
109 3300005618 Ga0068864_100278071 Ga0068864_1002780712 254
110 3300049569 Ga0501032_0156251 Ga0501032_0156251_192_1034 254
111 3300049571 Ga0501034_0028267 Ga0501034_0028267_4405_5247 254
112 3300049573 Ga0501037_0114037 Ga0501037_0114037_57_899 254
113 3300049579 Ga0501043_0005323 Ga0501043_0005323_268_1110 254
114 3300049579 Ga0501043_0193069 Ga0501043_0193069_397_1251 254
115 3300053098 Ga0500650_0060286 Ga0500650_0060286_290_1135 254
116 3300053142 Ga0500577_0094303 Ga0500577_0094303_348_1193 254
117 iso_pu_bacteria 2643221572 2643874685 254
118 iso_pu_bacteria 2643221669 2644381741 254
119 iso_pu_bacteria 2895660088 2895662944 254
120 3300005347 Ga0070668_100246737 Ga0070668_1002467372 255
121 3300005615 Ga0070702_100012583 Ga0070702_1000125833 255
122 3300009148 Ga0105243_10021950 Ga0105243_100219505 255
123 3300009553 Ga0105249_10093974 Ga0105249_100939743 255
124 3300013308 Ga0157375_11032970 Ga0157375_110329701 255
125 3300014325 Ga0163163_10626513 Ga0163163_106265131 255
126 3300025935 Ga0207709_10218744 Ga0207709_102187441 255
127 3300026088 Ga0207641_10355212 Ga0207641_103552122 255
128 3300028794 Ga0307515_10045366 Ga0307515_100453666 255
129 3300028794 Ga0307515_10382778 Ga0307515_103827781 255
130 3300048904 Ga0496101_0342756 Ga0496101_0342756_112_1071 255
131 3300048917 Ga0496114_0094900 Ga0496114_0094900_1421_2380 255
132 3300048922 Ga0496119_0009396 Ga0496119_0009396_78_929 255
133 3300048923 Ga0496120_0015167 Ga0496120_0015167_2953_3804 255
134 3300048924 Ga0496121_0013193 Ga0496121_0013193_5729_6559 255
135 3300050492 nmdc:mga0yw44_4761_c1 nmdc:mga0yw44_4761_c1_518_1369 255
136 3300053136 Ga0500559_0000712 Ga0500559_0000712_12191_13030 255
137 3300053140 Ga0500573_0000264 Ga0500573_0000264_19470_20309 255
138 3300053140 Ga0500573_0003430 Ga0500573_0003430_2396_3253 255
139 3300053140 Ga0500573_0006574 Ga0500573_0006574_293_1165 255
140 iso_pu_bacteria 2643221649 2644277529 255
141 3300002772 JGI25164J39214_1000531 JGI25164J39214_100053111 256
142 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002327 256
143 3300005437 Ga0070710_10014918 Ga0070710_100149182 256
144 3300025231 Ga0207427_100034 Ga0207427_100034255 256
145 3300025233 Ga0209437_100591 Ga0209437_10059111 256
146 3300025261 Ga0209233_1000001 Ga0209233_10000012478 256
147 3300025898 Ga0207692_10007124 Ga0207692_100071245 256
148 3300031649 Ga0307514_10020787 Ga0307514_100207875 256
149 3300032002 Ga0307416_100163207 Ga0307416_1001632072 256
150 3300032126 Ga0307415_100296708 Ga0307415_1002967081 256
151 3300044765 Ga0466970_0070450 Ga0466970_0070450_452_1312 256
152 3300047472 Ga0495686_0061572 Ga0495686_0061572_959_1819 256
153 3300049571 Ga0501034_0020022 Ga0501034_0020022_1382_2233 256
154 3300053139 Ga0500568_0026061 Ga0500568_0026061_69_1001 256
155 3300053153 Ga0500616_0000799 Ga0500616_0000799_13433_14365 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

77

305

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.7841 109 197
6xks-assembly3.cif.gz_C crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium 0.7396 17 252
6xks-assembly3.cif.gz_C crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium 0.7258 17 252
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.723 109 197
4oen-assembly1.cif.gz_A crystal structure of the second substrate binding domain of a putative amino acid abc transporter from streptococcus pneumoniae canada mdr_19a 0.668 19 247
ID Description Score Start End Superfamily
2yjpC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.852 110 197 3.40.190.10
5josA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.851 110 197 3.40.190.10
2pyyC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8507 108 198 3.40.190.10
2q2aC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8476 108 197 3.40.190.10
5l9mA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8438 109 202 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W1HJD4-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9567 20 256
AF-A0A2W1VDB4-F1-model_v4 deleted 0.9443 1 256
AF-A0A7W1HJD4-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9413 20 256
AF-A0A175RTB2-F1-model_v4 ABC transporter substrate-binding protein 0.9342 1 256 GO:0015276
GO:0016020
GO:0030313
AF-A0A175RTB2-F1-model_v4 ABC transporter substrate-binding protein 0.9306 1 256 GO:0015276
GO:0016020
GO:0030313

Feature Viewer

pLDDT pTM Quality
92.1 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map