F223391

General Info

Members Datasets Scaffolds Average Seq Length
155 102 154 204

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_114954_c1|nmdc:mga08x19_114954_c1_524_1168
Length 214
Sequence MFTGIVQEAGSVESVHKSSAGIRLAVRSPKAGAGLKIGDSVAVNGCCLTVVKLIPQLSRARAATGDRSRSERVVSFDLLHETWKRTNLQFAKAGALVNLERPLRADGRLDGHFVTGHIDGLGRIEKWERSGADHLLEVSAPSTIMRYIVSKGSIALDGISLTVAEVREERFVVWIIPHTYEVTAMRERKVGDAVNLETDILGKYVEKFVRPNNK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
44 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
48 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
57 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
58 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
59 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
60 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
61 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
62 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
102 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0.65
Rhizoplane 0.65
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4725145 2162886011 Bacteria 1273
2 rootH2_10016329 3300003320 Bacteria 7528
3 Ga0065712_10126025 3300005290 Bacteria 1607
4 Ga0070689_100000660 3300005340 Bacteria 20834
5 Ga0070691_10113560 3300005341 Unclassified 1357
6 Ga0070669_100376973 3300005353 Bacteria 1156
7 Ga0070688_100050125 3300005365 Bacteria 2600
8 Ga0070714_100141962 3300005435 Bacteria 2157
9 Ga0070681_10091534 3300005458 Bacteria 2991
10 Ga0070679_100932375 3300005530 Bacteria 812
11 Ga0068855_100011298 3300005563 Bacteria 10782
12 Ga0068855_100097115 3300005563 Bacteria 3394
13 Ga0068857_100062141 3300005577 Unclassified 3320
14 Ga0068857_100794735 3300005577 Bacteria 903
15 Ga0068856_100149971 3300005614 Bacteria 2340
16 Ga0068859_100713375 3300005617 Bacteria 1093
17 Ga0068864_100054951 3300005618 Bacteria 3437
18 Ga0068870_10038024 3300005840 Unclassified 2483
19 Ga0068863_100233329 3300005841 Bacteria 1775
20 Ga0070712_100704088 3300006175 Unclassified 861
21 Ga0075429_100469271 3300006880 Bacteria 1103
22 Ga0097620_100713448 3300006931 Bacteria 1093
23 Ga0105240_10036019 3300009093 Bacteria 6372
24 Ga0105240_10118505 3300009093 Bacteria 3190
25 Ga0105240_10192834 3300009093 Bacteria 2394
26 Ga0105240_11007147 3300009093 Bacteria 891
27 Ga0111539_10621352 3300009094 Unclassified 1258
28 Ga0105238_10001833 3300009551 Bacteria 21297
29 Ga0157370_10895614 3300013104 Bacteria 805
30 Ga0157374_10052598 3300013296 Bacteria 3794
31 Ga0157374_10554868 3300013296 Bacteria 1157
32 Ga0157374_10830614 3300013296 Bacteria 940
33 Ga0157374_10953707 3300013296 Unclassified 876
34 Ga0157378_10016886 3300013297 Bacteria 6397
35 Ga0157375_10258909 3300013308 Bacteria 1901
36 Ga0163163_10107725 3300014325 Bacteria 2813
37 Ga0157379_10097744 3300014968 Bacteria 2636
38 Ga0207643_10134322 3300025908 Bacteria 1474
39 Ga0207707_10071627 3300025912 Bacteria 3021
40 Ga0207695_10094506 3300025913 Bacteria 2996
41 Ga0207695_10439741 3300025913 Plasmid 1188
42 Ga0207694_10004426 3300025924 Bacteria 10983
43 Ga0207664_10122918 3300025929 Bacteria 2175
44 Ga0207670_10017045 3300025936 Bacteria 4383
45 Ga0207667_10110471 3300025949 Bacteria 2836
46 Ga0207702_10075250 3300026078 Bacteria 2916
47 Ga0207702_10446473 3300026078 Bacteria 1254
48 Ga0207702_10871349 3300026078 Bacteria 892
49 Ga0207641_10151635 3300026088 Bacteria 2100
50 Ga0207676_10096178 3300026095 Bacteria 2444
51 Ga0207676_10146740 3300026095 Bacteria 2027
52 Ga0207674_10020866 3300026116 Bacteria 7070
53 Ga0207674_10122321 3300026116 Unclassified 2568
54 Ga0265337_1001334 3300028556 Bacteria 12238
55 Ga0265337_1003892 3300028556 Bacteria 6325
56 Ga0265337_1024441 3300028556 Unclassified 1849
57 Ga0265323_10000524 3300028653 Bacteria 21302
58 Ga0265323_10048739 3300028653 Bacteria 1510
59 Ga0265323_10100672 3300028653 Bacteria 957
60 Ga0265323_10104291 3300028653 Bacteria 935
61 Ga0265322_10049448 3300028654 Bacteria 1194
62 Ga0265336_10000510 3300028666 Bacteria 22550
63 Ga0265336_10018600 3300028666 Bacteria 2250
64 Ga0265336_10087142 3300028666 Unclassified 931
65 Ga0265338_10000084 3300028800 Bacteria 175415
66 Ga0265338_10000626 3300028800 Bacteria 61483
67 Ga0265338_10000695 3300028800 Bacteria 57821
68 Ga0265338_10001714 3300028800 Bacteria 34782
69 Ga0265338_10003617 3300028800 Bacteria 21551
70 Ga0265338_10006737 3300028800 Bacteria 14511
71 Ga0265338_10009160 3300028800 Bacteria 11878
72 Ga0265338_10010525 3300028800 Bacteria 10818
73 Ga0265338_10041943 3300028800 Bacteria 4271
74 Ga0265338_10060282 3300028800 Bacteria 3336
75 Ga0265338_10091244 3300028800 Bacteria 2518
76 Ga0265338_10353813 3300028800 Bacteria 1055
77 Ga0265338_10736936 3300028800 Unclassified 678
78 Ga0265324_10000637 3300029957 Bacteria 23808
79 Ga0265324_10014131 3300029957 Unclassified 2962
80 Ga0265332_10052901 3300031238 Unclassified 1743
81 Ga0265320_10000145 3300031240 Bacteria 59716
82 Ga0265320_10000985 3300031240 Bacteria 21185
83 Ga0265320_10119976 3300031240 Bacteria 1200
84 Ga0265320_10181916 3300031240 Bacteria 942
85 Ga0265340_10000400 3300031247 Bacteria 23246
86 Ga0265331_10163812 3300031250 Bacteria 1007
87 Ga0265327_10000767 3300031251 Bacteria 49654
88 Ga0265327_10029234 3300031251 Bacteria 3138
89 Ga0265327_10057434 3300031251 Archaea 2002
90 Ga0265316_10023278 3300031344 Bacteria 5207
91 Ga0265316_10107487 3300031344 Bacteria 2115
92 Ga0265316_10191733 3300031344 Unclassified 1518
93 Ga0265316_10209002 3300031344 Bacteria 1444
94 Ga0265314_10119292 3300031711 Bacteria 1663
95 Ga0265342_10048552 3300031712 Unclassified 2544
96 Ga0265342_10155586 3300031712 Bacteria 1267
97 Ga0316576_10382995 3300031727 Unclassified 1044
98 Ga0316576_10438149 3300031727 Bacteria 966
99 Ga0316583_10006256 3300032133 Bacteria 4278
100 Ga0316583_10017092 3300032133 Bacteria 2609
101 Ga0316583_10052435 3300032133 Bacteria 1435
102 Ga0373928_0000600 3300035084 Bacteria 7085
103 Ga0373929_0000194 3300035085 Bacteria 10890
104 Ga0373944_0002247 3300035089 Bacteria 4912
105 Ga0373949_0040872 3300035090 Unclassified 1139
106 Ga0373932_0000004 3300035112 Bacteria 412176
107 Ga0373953_0050185 3300035117 Bacteria 1685
108 Ga0373956_0023006 3300035119 Bacteria 2671
109 Ga0373943_0115279 3300035170 Bacteria 1422
110 Ga0373955_0090853 3300035172 Bacteria 1740
111 Ga0373962_0000711 3300035242 Bacteria 7534
112 Ga0316574_0106879 3300035398 Unclassified 1793
113 Ga0373924_0034434 3300035410 Bacteria 2050
114 Ga0373931_0000036 3300035691 Bacteria 79351
115 Ga0373931_0180178 3300035691 Bacteria 1251
116 Ga0373927_0334686 3300035695 Bacteria 997
117 Ga0373947_0229596 3300035725 Unclassified 1222
118 Ga0373937_0054556 3300036401 Bacteria 3668
119 Ga0373937_0116435 3300036401 Bacteria 2489
120 Ga0373937_0613965 3300036401 Bacteria 1032
121 Ga0373925_0000171 3300037068 Bacteria 70398
122 Ga0451577_0003128 3300042876 Bacteria 18670
123 Ga0453684_0020291 3300044712 Bacteria 10035
124 Ga0453684_0453011 3300044712 Unclassified 1428
125 Ga0451576_0109484 3300045051 Bacteria 2875
126 Ga0495641_0216854 3300046461 Bacteria 858
127 Ga0495651_0163615 3300046462 Bacteria 1592
128 Ga0495639_0115328 3300046475 Unclassified 1278
129 Ga0495662_0200031 3300046476 Unclassified 985
130 Ga0495618_0183058 3300046514 Bacteria 1331
131 Ga0495630_0000090 3300046517 Bacteria 71226
132 Ga0495630_0460865 3300046517 Unclassified 974
133 Ga0495666_0001142 3300046526 Bacteria 12730
134 Ga0495586_0000059 3300046535 Bacteria 66207
135 Ga0495586_0041455 3300046535 Unclassified 2479
136 Ga0495645_0217411 3300046543 Bacteria 1287
137 Ga0495667_0438919 3300046559 Bacteria 821
138 Ga0495634_0014979 3300046642 Bacteria 5576
139 Ga0495599_0040520 3300046678 Bacteria 2925
140 Ga0495613_0021205 3300046689 Bacteria 4846
141 Ga0495613_0251166 3300046689 Bacteria 1234
142 Ga0495674_0000212 3300047319 Bacteria 48127
143 Ga0495676_0033384 3300047321 Bacteria 4335
144 Ga0495675_0077513 3300047444 Bacteria 2094
145 Ga0495614_0127182 3300048089 Unclassified 1126
146 Ga0496115_0165583 3300048918 Unclassified 1828
147 Ga0501047_0341039 3300049581 Bacteria 1336
148 nmdc:mga09592_218125_c1 3300050508 Unclassified 1653
149 nmdc:mga08y16_437050_c1 3300050511 Unclassified 1336
150 nmdc:mga08y16_452998_c1 3300050511 Unclassified 1308
151 nmdc:mga0rr50_965216_c1 3300050513 Unclassified 726
152 nmdc:mga08x19_114954_c1 3300050514 Bacteria 1798
153 nmdc:mga0a205_683950_c1 3300050515 Unclassified 876
154 Ga0500651_0224219 3300053093 Unclassified 1101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_683950_c1 nmdc:mga0a205_683950_c1_21_539 169
2 3300013296 Ga0157374_10554868 Ga0157374_105548682 199
3 3300005530 Ga0070679_100932375 Ga0070679_1009323751 200
4 3300026116 Ga0207674_10020866 Ga0207674_100208663 200
5 3300028800 Ga0265338_10010525 Ga0265338_100105258 201
6 3300028800 Ga0265338_10091244 Ga0265338_100912442 201
7 3300031727 Ga0316576_10438149 Ga0316576_104381491 201
8 3300032133 Ga0316583_10006256 Ga0316583_100062562 201
9 3300032133 Ga0316583_10017092 Ga0316583_100170922 201
10 3300032133 Ga0316583_10052435 Ga0316583_100524352 201
11 iso_pu_bacteria 643348564 643602924 201
12 3300003320 rootH2_10016329 rootH2_100163295 202
13 3300005353 Ga0070669_100376973 Ga0070669_1003769731 202
14 3300005614 Ga0068856_100149971 Ga0068856_1001499712 202
15 3300013296 Ga0157374_10830614 Ga0157374_108306141 202
16 3300013308 Ga0157375_10258909 Ga0157375_102589092 202
17 3300026078 Ga0207702_10075250 Ga0207702_100752503 202
18 3300026078 Ga0207702_10446473 Ga0207702_104464732 202
19 3300028666 Ga0265336_10018600 Ga0265336_100186002 202
20 3300028800 Ga0265338_10000084 Ga0265338_10000084104 202
21 3300028800 Ga0265338_10003617 Ga0265338_1000361713 202
22 3300028800 Ga0265338_10353813 Ga0265338_103538131 202
23 3300029957 Ga0265324_10000637 Ga0265324_1000063717 202
24 3300029957 Ga0265324_10014131 Ga0265324_100141312 202
25 3300031250 Ga0265331_10163812 Ga0265331_101638121 202
26 3300031251 Ga0265327_10000767 Ga0265327_1000076726 202
27 3300031251 Ga0265327_10029234 Ga0265327_100292342 202
28 3300031251 Ga0265327_10057434 Ga0265327_100574342 202
29 3300031344 Ga0265316_10107487 Ga0265316_101074872 202
30 3300035725 Ga0373947_0229596 Ga0373947_0229596_444_1052 202
31 3300042876 Ga0451577_0003128 Ga0451577_0003128_13465_14073 202
32 3300044712 Ga0453684_0020291 Ga0453684_0020291_4803_5411 202
33 3300044712 Ga0453684_0453011 Ga0453684_0453011_168_776 202
34 3300045051 Ga0451576_0109484 Ga0451576_0109484_1704_2495 202
35 3300046461 Ga0495641_0216854 Ga0495641_0216854_187_795 202
36 3300046476 Ga0495662_0200031 Ga0495662_0200031_236_844 202
37 3300046514 Ga0495618_0183058 Ga0495618_0183058_236_844 202
38 3300046517 Ga0495630_0000090 Ga0495630_0000090_45489_46097 202
39 3300046526 Ga0495666_0001142 Ga0495666_0001142_5571_6179 202
40 3300046535 Ga0495586_0000059 Ga0495586_0000059_40470_41078 202
41 3300046642 Ga0495634_0014979 Ga0495634_0014979_4747_5355 202
42 3300046689 Ga0495613_0021205 Ga0495613_0021205_2873_3481 202
43 3300047319 Ga0495674_0000212 Ga0495674_0000212_18207_18815 202
44 3300047321 Ga0495676_0033384 Ga0495676_0033384_2269_2877 202
45 3300047444 Ga0495675_0077513 Ga0495675_0077513_1287_1919 202
46 3300050514 nmdc:mga08x19_114954_c1 nmdc:mga08x19_114954_c1_524_1168 202
47 3300005341 Ga0070691_10113560 Ga0070691_101135602 203
48 3300005435 Ga0070714_100141962 Ga0070714_1001419622 203
49 3300005458 Ga0070681_10091534 Ga0070681_100915343 203
50 3300005563 Ga0068855_100011298 Ga0068855_1000112983 203
51 3300005577 Ga0068857_100062141 Ga0068857_1000621412 203
52 3300005617 Ga0068859_100713375 Ga0068859_1007133751 203
53 3300005618 Ga0068864_100054951 Ga0068864_1000549514 203
54 3300005840 Ga0068870_10038024 Ga0068870_100380242 203
55 3300005841 Ga0068863_100233329 Ga0068863_1002333292 203
56 3300006175 Ga0070712_100704088 Ga0070712_1007040881 203
57 3300006931 Ga0097620_100713448 Ga0097620_1007134481 203
58 3300009093 Ga0105240_10036019 Ga0105240_100360193 203
59 3300009093 Ga0105240_10118505 Ga0105240_101185054 203
60 3300009093 Ga0105240_10192834 Ga0105240_101928342 203
61 3300013104 Ga0157370_10895614 Ga0157370_108956141 203
62 3300013296 Ga0157374_10052598 Ga0157374_100525983 203
63 3300013296 Ga0157374_10953707 Ga0157374_109537071 203
64 3300013297 Ga0157378_10016886 Ga0157378_100168867 203
65 3300014325 Ga0163163_10107725 Ga0163163_101077253 203
66 3300014968 Ga0157379_10097744 Ga0157379_100977442 203
67 3300025908 Ga0207643_10134322 Ga0207643_101343222 203
68 3300025912 Ga0207707_10071627 Ga0207707_100716272 203
69 3300025913 Ga0207695_10094506 Ga0207695_100945063 203
70 3300025913 Ga0207695_10439741 Ga0207695_104397412 203
71 3300025929 Ga0207664_10122918 Ga0207664_101229182 203
72 3300026078 Ga0207702_10871349 Ga0207702_108713492 203
73 3300026088 Ga0207641_10151635 Ga0207641_101516353 203
74 3300026095 Ga0207676_10096178 Ga0207676_100961782 203
75 3300026095 Ga0207676_10146740 Ga0207676_101467402 203
76 3300026116 Ga0207674_10122321 Ga0207674_101223212 203
77 3300028556 Ga0265337_1001334 Ga0265337_10013348 203
78 3300028556 Ga0265337_1003892 Ga0265337_10038923 203
79 3300028653 Ga0265323_10000524 Ga0265323_1000052420 203
80 3300028653 Ga0265323_10100672 Ga0265323_101006721 203
81 3300028654 Ga0265322_10049448 Ga0265322_100494482 203
82 3300028666 Ga0265336_10000510 Ga0265336_100005106 203
83 3300028666 Ga0265336_10087142 Ga0265336_100871422 203
84 3300028800 Ga0265338_10000626 Ga0265338_100006264 203
85 3300028800 Ga0265338_10000695 Ga0265338_1000069535 203
86 3300028800 Ga0265338_10001714 Ga0265338_1000171420 203
87 3300028800 Ga0265338_10006737 Ga0265338_100067372 203
88 3300028800 Ga0265338_10009160 Ga0265338_100091605 203
89 3300028800 Ga0265338_10060282 Ga0265338_100602822 203
90 3300031238 Ga0265332_10052901 Ga0265332_100529012 203
91 3300031240 Ga0265320_10000145 Ga0265320_1000014516 203
92 3300031240 Ga0265320_10000985 Ga0265320_1000098514 203
93 3300031240 Ga0265320_10119976 Ga0265320_101199762 203
94 3300031240 Ga0265320_10181916 Ga0265320_101819162 203
95 3300031247 Ga0265340_10000400 Ga0265340_1000040025 203
96 3300031344 Ga0265316_10023278 Ga0265316_100232782 203
97 3300031344 Ga0265316_10191733 Ga0265316_101917332 203
98 3300031711 Ga0265314_10119292 Ga0265314_101192922 203
99 3300031712 Ga0265342_10048552 Ga0265342_100485523 203
100 3300031712 Ga0265342_10155586 Ga0265342_101555862 203
101 3300031727 Ga0316576_10382995 Ga0316576_103829952 203
102 3300035084 Ga0373928_0000600 Ga0373928_0000600_435_1046 203
103 3300035085 Ga0373929_0000194 Ga0373929_0000194_2244_2855 203
104 3300035089 Ga0373944_0002247 Ga0373944_0002247_3046_3657 203
105 3300035090 Ga0373949_0040872 Ga0373949_0040872_342_953 203
106 3300035112 Ga0373932_0000004 Ga0373932_0000004_225118_225729 203
107 3300035117 Ga0373953_0050185 Ga0373953_0050185_377_988 203
108 3300035119 Ga0373956_0023006 Ga0373956_0023006_180_791 203
109 3300035170 Ga0373943_0115279 Ga0373943_0115279_32_643 203
110 3300035172 Ga0373955_0090853 Ga0373955_0090853_611_1222 203
111 3300035242 Ga0373962_0000711 Ga0373962_0000711_879_1490 203
112 3300035398 Ga0316574_0106879 Ga0316574_0106879_722_1333 203
113 3300035410 Ga0373924_0034434 Ga0373924_0034434_1264_1875 203
114 3300035691 Ga0373931_0000036 Ga0373931_0000036_34964_35575 203
115 3300035691 Ga0373931_0180178 Ga0373931_0180178_153_764 203
116 3300035695 Ga0373927_0334686 Ga0373927_0334686_362_973 203
117 3300036401 Ga0373937_0054556 Ga0373937_0054556_638_1249 203
118 3300036401 Ga0373937_0116435 Ga0373937_0116435_376_987 203
119 3300036401 Ga0373937_0613965 Ga0373937_0613965_54_665 203
120 3300037068 Ga0373925_0000171 Ga0373925_0000171_10102_10713 203
121 3300046462 Ga0495651_0163615 Ga0495651_0163615_292_903 203
122 3300046559 Ga0495667_0438919 Ga0495667_0438919_110_721 203
123 3300046678 Ga0495599_0040520 Ga0495599_0040520_83_745 203
124 3300046689 Ga0495613_0251166 Ga0495613_0251166_232_843 203
125 3300048918 Ga0496115_0165583 Ga0496115_0165583_1041_1652 203
126 3300049581 Ga0501047_0341039 Ga0501047_0341039_330_941 203
127 3300050513 nmdc:mga0rr50_965216_c1 nmdc:mga0rr50_965216_c1_31_642 203
128 3300053093 Ga0500651_0224219 Ga0500651_0224219_303_914 203
129 3300046535 Ga0495586_0041455 Ga0495586_0041455_1099_1713 204
130 2162886011 MRS1b_contig_4725145 MRS1b_0713.00001490 205
131 3300005290 Ga0065712_10126025 Ga0065712_101260252 205
132 3300005340 Ga0070689_100000660 Ga0070689_10000066015 205
133 3300005365 Ga0070688_100050125 Ga0070688_1000501252 205
134 3300005563 Ga0068855_100097115 Ga0068855_1000971152 205
135 3300005577 Ga0068857_100794735 Ga0068857_1007947351 205
136 3300006880 Ga0075429_100469271 Ga0075429_1004692711 205
137 3300009093 Ga0105240_11007147 Ga0105240_110071471 205
138 3300009094 Ga0111539_10621352 Ga0111539_106213521 205
139 3300009551 Ga0105238_10001833 Ga0105238_1000183311 205
140 3300025924 Ga0207694_10004426 Ga0207694_100044265 205
141 3300025936 Ga0207670_10017045 Ga0207670_100170453 205
142 3300025949 Ga0207667_10110471 Ga0207667_101104713 205
143 3300028556 Ga0265337_1024441 Ga0265337_10244412 205
144 3300028653 Ga0265323_10048739 Ga0265323_100487392 205
145 3300028653 Ga0265323_10104291 Ga0265323_101042912 205
146 3300028800 Ga0265338_10041943 Ga0265338_100419432 205
147 3300028800 Ga0265338_10736936 Ga0265338_107369361 205
148 3300031344 Ga0265316_10209002 Ga0265316_102090021 205
149 3300046475 Ga0495639_0115328 Ga0495639_0115328_312_929 205
150 3300046517 Ga0495630_0460865 Ga0495630_0460865_149_775 205
151 3300046543 Ga0495645_0217411 Ga0495645_0217411_228_854 205
152 3300048089 Ga0495614_0127182 Ga0495614_0127182_102_719 205
153 3300050508 nmdc:mga09592_218125_c1 nmdc:mga09592_218125_c1_380_997 205
154 3300050511 nmdc:mga08y16_437050_c1 nmdc:mga08y16_437050_c1_70_687 205
155 3300050511 nmdc:mga08y16_452998_c1 nmdc:mga08y16_452998_c1_359_976 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

115

199

0.99

PF00677

Lum_binding

Lumazine binding domain

3

102

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9321 1 90
3ddy-assembly1.cif.gz_A structure of lumazine protein, an optical transponder of luminescent bacteria 0.9218 1 187
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9218 1 90
3a3b-assembly1.cif.gz_B crystal structure of lump complexed with flavin mononucleotide 0.9188 1 187
3a3g-assembly2.cif.gz_B crystal structure of lump complexed with 6,7-dimethyl-8-(1'-d-ribityl) lumazine 0.9149 1 187
ID Description Score Start End Superfamily
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9705 1 91 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9661 105 195 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9599 1 91 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9458 105 195 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9444 1 91 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A7C5D2L2-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9383 1 162 GO:0004746
GO:0009231
AF-A0A7C5D2L2-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9327 1 162 GO:0004746
GO:0009231
AF-A0A0F0CST5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9325 1 194 GO:0004746
GO:0009231
AF-A0A1S9CM18-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9278 1 196 GO:0004746
GO:0009231
AF-A0A3N5B421-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.927 1 198 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
85.52 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map