F223291

General Info

Members Datasets Scaffolds Average Seq Length
155 104 310 143

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0013233|Ga0501046_0013233_135_602
Length 155
Sequence VAPASTSGLFSRFGPPAKTKFLLLGSPDFRSENLMNWGRSLNLEHVSPARMKGPEISRRPASAAAEEVNLLARMRRWFFTRKPDAGFVLTDFPATLLQALVLDEWLDARDEALSAVMVAGPGSSESVVSHYRTLGLLVEAGEPQLSAALVPEGRS

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
37 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
38 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
39 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
75 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
76 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 6.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0013233 3300049580 Bacteria 6991
2 rootH2_10100013 3300003320 Bacteria 1477
3 rootL2_10003553 3300003322 Bacteria 2617
4 Ga0070683_100005686 3300005329 Bacteria 10413
5 Ga0070683_100553618 3300005329 Bacteria 1100
6 Ga0070690_100761797 3300005330 Bacteria 748
7 Ga0070682_100944682 3300005337 Bacteria 712
8 Ga0068868_101473049 3300005338 Bacteria 637
9 Ga0070687_100359726 3300005343 Bacteria 942
10 Ga0070674_101668613 3300005356 Bacteria 576
11 Ga0070678_100531395 3300005456 Bacteria 1042
12 Ga0070681_11778665 3300005458 Bacteria 543
13 Ga0068867_101926354 3300005459 Bacteria 558
14 Ga0070679_101490017 3300005530 Bacteria 623
15 Ga0070684_100720250 3300005535 Bacteria 931
16 Ga0070686_101452961 3300005544 Bacteria 577
17 Ga0068855_100818281 3300005563 Bacteria 989
18 Ga0068859_102099850 3300005617 Bacteria 624
19 Ga0097620_102100127 3300006931 Bacteria 624
20 Ga0105245_10672367 3300009098 Bacteria 1067
21 Ga0105242_10865218 3300009176 Bacteria 901
22 Ga0157369_10540318 3300013105 Bacteria 1205
23 Ga0157375_10840404 3300013308 Bacteria 1065
24 Ga0157375_12043537 3300013308 Bacteria 681
25 Ga0163163_10294829 3300014325 Bacteria 1674
26 Ga0157380_11239335 3300014326 Bacteria 791
27 Ga0157377_10594419 3300014745 Bacteria 788
28 Ga0157377_10956181 3300014745 Bacteria 645
29 Ga0157376_11014569 3300014969 Bacteria 853
30 Ga0207693_10302256 3300025915 Bacteria 1253
31 Ga0207662_10040378 3300025918 Bacteria 2743
32 Ga0207687_10652720 3300025927 Bacteria 890
33 Ga0207686_10509838 3300025934 Bacteria 935
34 Ga0207691_10515003 3300025940 Bacteria 1015
35 Ga0207661_10012217 3300025944 Bacteria 6237
36 Ga0207667_10761604 3300025949 Bacteria 967
37 Ga0207702_10161809 3300026078 Bacteria 2044
38 Ga0207683_10280680 3300026121 Bacteria 1522
39 Ga0265337_1016807 3300028556 Bacteria 2358
40 Ga0265337_1022636 3300028556 Bacteria 1943
41 Ga0265319_1000330 3300028563 Bacteria 34865
42 Ga0265319_1002872 3300028563 Bacteria 9202
43 Ga0265334_10030885 3300028573 Bacteria 2143
44 Ga0265318_10000422 3300028577 Bacteria 32552
45 Ga0265318_10068759 3300028577 Bacteria 1313
46 Ga0265322_10020216 3300028654 Bacteria 1909
47 Ga0265322_10075754 3300028654 Bacteria 955
48 Ga0265336_10019164 3300028666 Bacteria 2210
49 Ga0265338_10000919 3300028800 Bacteria 49615
50 Ga0265338_10189022 3300028800 Bacteria 1563
51 Ga0265338_10201426 3300028800 Bacteria 1501
52 Ga0265324_10100983 3300029957 Bacteria 980
53 Ga0265324_10187248 3300029957 Bacteria 703
54 Ga0265762_1052676 3300030760 Bacteria 821
55 Ga0265776_104132 3300030880 Bacteria 729
56 Ga0265776_105440 3300030880 Bacteria 670
57 Ga0265332_10041473 3300031238 Bacteria 1991
58 Ga0265332_10041821 3300031238 Bacteria 1982
59 Ga0265332_10140677 3300031238 Bacteria 1011
60 Ga0265332_10200779 3300031238 Bacteria 829
61 Ga0265320_10000430 3300031240 Bacteria 33126
62 Ga0265320_10007615 3300031240 Bacteria 6708
63 Ga0265320_10020087 3300031240 Bacteria 3631
64 Ga0265320_10084115 3300031240 Bacteria 1482
65 Ga0265320_10131612 3300031240 Bacteria 1136
66 Ga0265325_10017848 3300031241 Bacteria 3941
67 Ga0265329_10076736 3300031242 Bacteria 1057
68 Ga0265329_10121494 3300031242 Bacteria 838
69 Ga0265340_10024721 3300031247 Bacteria 3048
70 Ga0265340_10083346 3300031247 Bacteria 1503
71 Ga0265339_10147997 3300031249 Bacteria 1190
72 Ga0265331_10181969 3300031250 Bacteria 949
73 Ga0265331_10401659 3300031250 Bacteria 614
74 Ga0265331_10497609 3300031250 Bacteria 548
75 Ga0265327_10006465 3300031251 Bacteria 9359
76 Ga0265327_10100833 3300031251 Bacteria 1393
77 Ga0265327_10112224 3300031251 Bacteria 1301
78 Ga0265316_10506080 3300031344 Bacteria 862
79 Ga0265313_10000667 3300031595 Bacteria 35343
80 Ga0265313_10091639 3300031595 Bacteria 1363
81 Ga0265314_10003296 3300031711 Bacteria 15770
82 Ga0265314_10162828 3300031711 Bacteria 1355
83 Ga0265314_10238302 3300031711 Bacteria 1051
84 Ga0265314_10488889 3300031711 Bacteria 649
85 Ga0265314_10503846 3300031711 Bacteria 637
86 Ga0265342_10081051 3300031712 Bacteria 1874
87 Ga0307405_10954189 3300031731 Bacteria 729
88 Ga0307406_11765018 3300031901 Bacteria 549
89 Ga0307409_100341788 3300031995 Bacteria 1409
90 Ga0307414_10503638 3300032004 Bacteria 1072
91 Ga0373961_0394299 3300035241 Bacteria 530
92 Ga0373933_0174294 3300035724 Bacteria 1370
93 Ga0373937_0525166 3300036401 Bacteria 1125
94 Ga0395905_0279271 3300037471 Bacteria 1556
95 Ga0451805_032962 3300041461 Bacteria 719
96 Ga0451577_1091257 3300042876 Bacteria 714
97 Ga0453683_0004775 3300044673 Bacteria 9552
98 Ga0466957_0502318 3300044842 Unclassified 841
99 Ga0451576_0027216 3300045051 Bacteria 6143
100 Ga0451576_0036778 3300045051 Bacteria 5187
101 Ga0451576_0085026 3300045051 Bacteria 3290
102 Ga0451576_0910541 3300045051 Bacteria 923
103 Ga0495608_0618212 3300046511 Bacteria 649
104 Ga0495667_0728538 3300046559 Bacteria 614
105 Ga0495599_0222645 3300046678 Bacteria 1154
106 Ga0495600_0245513 3300046809 Bacteria 1140
107 Ga0495636_0034443 3300047318 Bacteria 2084
108 Ga0495675_0693530 3300047444 Bacteria 571
109 Ga0495684_0149834 3300047471 Bacteria 1745
110 Ga0501306_071339 3300049127 Bacteria 587
111 Ga0501308_025632 3300049128 Bacteria 765
112 Ga0501309_025562 3300049129 Bacteria 849
113 Ga0501304_010885 3300049160 Bacteria 801
114 Ga0501305_049857 3300049161 Bacteria 700
115 Ga0501311_028079 3300049527 Bacteria 801
116 Ga0501031_0010112 3300049568 Bacteria 6148
117 Ga0501032_0004293 3300049569 Bacteria 10761
118 Ga0501032_0006919 3300049569 Bacteria 8314
119 Ga0501033_0005284 3300049570 Bacteria 10246
120 Ga0501033_0006719 3300049570 Bacteria 8988
121 Ga0501034_0072746 3300049571 Bacteria 3446
122 Ga0501036_0004436 3300049572 Bacteria 11340
123 Ga0501037_0009887 3300049573 Bacteria 6996
124 Ga0501037_0018702 3300049573 Bacteria 5106
125 Ga0501037_0168935 3300049573 Bacteria 1556
126 Ga0501038_0004183 3300049574 Bacteria 13419
127 Ga0501038_0086602 3300049574 Bacteria 2632
128 Ga0501039_0001456 3300049575 Bacteria 17399
129 Ga0501039_0461025 3300049575 Bacteria 998
130 Ga0501040_0485754 3300049576 Bacteria 890
131 Ga0501042_0030995 3300049578 Bacteria 3782
132 Ga0501043_0055730 3300049579 Bacteria 3105
133 Ga0501043_0131071 3300049579 Bacteria 1965
134 Ga0501043_0502991 3300049579 Bacteria 905
135 Ga0501046_0005441 3300049580 Bacteria 11382
136 Ga0501046_0005999 3300049580 Bacteria 10806
137 Ga0501047_0026446 3300049581 Bacteria 5582
138 Ga0501047_0042858 3300049581 Bacteria 4372
139 Ga0501047_0144388 3300049581 Bacteria 2257
140 Ga0501047_0511120 3300049581 Bacteria 1027
141 Ga0501048_0004214 3300049582 Bacteria 10960
142 Ga0501068_0341863 3300049584 Bacteria 961
143 Ga0501070_0098010 3300049586 Bacteria 2425
144 Ga0501070_0365240 3300049586 Bacteria 1170
145 Ga0501080_0174735 3300049742 Bacteria 1980
146 Ga0501080_0250324 3300049742 Bacteria 1616
147 Ga0501083_0016217 3300049744 Bacteria 5219
148 Ga0501035_0012289 3300049822 Bacteria 7914
149 Ga0501035_0040966 3300049822 Bacteria 4183
150 Ga0501035_0681117 3300049822 Bacteria 831
151 Ga0501035_0721549 3300049822 Bacteria 802
152 Ga0501044_0031245 3300049823 Bacteria 5606
153 Ga0501044_0041030 3300049823 Bacteria 4818
154 Ga0501045_0023324 3300049824 Bacteria 4435
155 Ga0501082_0332293 3300060353 Bacteria 1324
156 Ga0501046_0013233
157 rootH2_10100013
158 rootL2_10003553
159 Ga0070683_100005686
160 Ga0070683_100553618
161 Ga0070690_100761797
162 Ga0070682_100944682
163 Ga0068868_101473049
164 Ga0070687_100359726
165 Ga0070674_101668613
166 Ga0070678_100531395
167 Ga0070681_11778665
168 Ga0068867_101926354
169 Ga0070679_101490017
170 Ga0070684_100720250
171 Ga0070686_101452961
172 Ga0068855_100818281
173 Ga0068859_102099850
174 Ga0097620_102100127
175 Ga0105245_10672367
176 Ga0105242_10865218
177 Ga0157369_10540318
178 Ga0157375_10840404
179 Ga0157375_12043537
180 Ga0163163_10294829
181 Ga0157380_11239335
182 Ga0157377_10594419
183 Ga0157377_10956181
184 Ga0157376_11014569
185 Ga0207693_10302256
186 Ga0207662_10040378
187 Ga0207687_10652720
188 Ga0207686_10509838
189 Ga0207691_10515003
190 Ga0207661_10012217
191 Ga0207667_10761604
192 Ga0207702_10161809
193 Ga0207683_10280680
194 Ga0265337_1016807
195 Ga0265337_1022636
196 Ga0265319_1000330
197 Ga0265319_1002872
198 Ga0265334_10030885
199 Ga0265318_10000422
200 Ga0265318_10068759
201 Ga0265322_10020216
202 Ga0265322_10075754
203 Ga0265336_10019164
204 Ga0265338_10000919
205 Ga0265338_10189022
206 Ga0265338_10201426
207 Ga0265324_10100983
208 Ga0265324_10187248
209 Ga0265762_1052676
210 Ga0265776_104132
211 Ga0265776_105440
212 Ga0265332_10041473
213 Ga0265332_10041821
214 Ga0265332_10140677
215 Ga0265332_10200779
216 Ga0265320_10000430
217 Ga0265320_10007615
218 Ga0265320_10020087
219 Ga0265320_10084115
220 Ga0265320_10131612
221 Ga0265325_10017848
222 Ga0265329_10076736
223 Ga0265329_10121494
224 Ga0265340_10024721
225 Ga0265340_10083346
226 Ga0265339_10147997
227 Ga0265331_10181969
228 Ga0265331_10401659
229 Ga0265331_10497609
230 Ga0265327_10006465
231 Ga0265327_10100833
232 Ga0265327_10112224
233 Ga0265316_10506080
234 Ga0265313_10000667
235 Ga0265313_10091639
236 Ga0265314_10003296
237 Ga0265314_10162828
238 Ga0265314_10238302
239 Ga0265314_10488889
240 Ga0265314_10503846
241 Ga0265342_10081051
242 Ga0307405_10954189
243 Ga0307406_11765018
244 Ga0307409_100341788
245 Ga0307414_10503638
246 Ga0373961_0394299
247 Ga0373933_0174294
248 Ga0373937_0525166
249 Ga0395905_0279271
250 Ga0451805_032962
251 Ga0451577_1091257
252 Ga0453683_0004775
253 Ga0466957_0502318
254 Ga0451576_0027216
255 Ga0451576_0036778
256 Ga0451576_0085026
257 Ga0451576_0910541
258 Ga0495608_0618212
259 Ga0495667_0728538
260 Ga0495599_0222645
261 Ga0495600_0245513
262 Ga0495636_0034443
263 Ga0495675_0693530
264 Ga0495684_0149834
265 Ga0501306_071339
266 Ga0501308_025632
267 Ga0501309_025562
268 Ga0501304_010885
269 Ga0501305_049857
270 Ga0501311_028079
271 Ga0501031_0010112
272 Ga0501032_0004293
273 Ga0501032_0006919
274 Ga0501033_0005284
275 Ga0501033_0006719
276 Ga0501034_0072746
277 Ga0501036_0004436
278 Ga0501037_0009887
279 Ga0501037_0018702
280 Ga0501037_0168935
281 Ga0501038_0004183
282 Ga0501038_0086602
283 Ga0501039_0001456
284 Ga0501039_0461025
285 Ga0501040_0485754
286 Ga0501042_0030995
287 Ga0501043_0055730
288 Ga0501043_0131071
289 Ga0501043_0502991
290 Ga0501046_0005441
291 Ga0501046_0005999
292 Ga0501047_0026446
293 Ga0501047_0042858
294 Ga0501047_0144388
295 Ga0501047_0511120
296 Ga0501048_0004214
297 Ga0501068_0341863
298 Ga0501070_0098010
299 Ga0501070_0365240
300 Ga0501080_0174735
301 Ga0501080_0250324
302 Ga0501083_0016217
303 Ga0501035_0012289
304 Ga0501035_0040966
305 Ga0501035_0681117
306 Ga0501035_0721549
307 Ga0501044_0031245
308 Ga0501044_0041030
309 Ga0501045_0023324
310 Ga0501082_0332293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g3y-assembly1.cif.gz_A crystal structure of adenylate kinase ancestor 1 with zn and adp bound 0.6943 17 136
4qbh-assembly2.cif.gz_B crystal structure of a stable adenylate kinase variant aklse5 0.6891 17 136
2osb-assembly2.cif.gz_B crystal structure of a thermostable mutant of bacillus subtilis adenylate kinase (q16l/q199r/) 0.6851 17 136
5g3z-assembly1.cif.gz_A crystal structure of adenylate kinase ancestor 3 with zn, mg and ap5a bound 0.6798 17 140
1dvr-assembly1.cif.gz_B structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp 0.677 16 141
ID Description Score Start End Superfamily
af_A0A0R0KBV4_1_209_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.7057 93 136 3.40.640.10
af_Q54CT8_14_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6747 13 136 3.40.50.300
af_A0A1D6ELE7_246_421_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6604 91 136 3.40.640.10
4ikeB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6594 17 140 3.40.50.300
4typB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6412 17 118 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1D8AR92-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.8378 66 136 GO:0004017
AF-A0A3E1ENS4-F1-model_v4 Adenylate kinase 0.7704 1 136 GO:0016301
AF-A0A2A2RJ66-F1-model_v4 Adenylate kinase 0.7555 52 134
AF-A0A139SKL3-F1-model_v4 Adenylate kinase 0.7363 1 136
AF-A0A0E3UJF7-F1-model_v4 Adenylate kinase 0.7332 1 136

Map