F223263

General Info

Members Datasets Scaffolds Average Seq Length
155 110 310 246

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0200631|Ga0501034_0200631_193_1041
Length 282
Sequence MDFAALLEPTAWMAILTLTFLEIVLGIDNIVFISIISGKLPENERKKATNIGLFLAMLLRIGLLFGITWLMSLTKPISWLTFDLPFLKGGLTWQSLIILGGGLFLLYKSVKEIHHKLEDDEDASEINPKGKLSLANAIIQILLINIVFSFDSILTAVGMVSFQEFGKAGALEIMGFSVIISIVLMMVFAVPISKFVNKHPTIQMLALSFLILIGVMLLAEASHLGHLEIFGSEIGAIPKGYIYFAIFFALLVEVFNMQYRKRKSKPVELHNSPTMDDVKNQD

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
60 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
61 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
62 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
63 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
64 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
65 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
78 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
79 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
88 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
89 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
93 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
96 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
97 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
98 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
99 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
100 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
101 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
102 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
103 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
104 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
105 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
106 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
107 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
108 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
109 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
110 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 90.32
Metatranscriptomes 0
Isolates 9.68

Biome Distribution

Category Percentage (%)
Aerial Root 1.29
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 1.94
Rhizosphere 85.81
Stem 0
Stem Tuber 0
Unclassified 10.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0200631 3300049571 Bacteria 1953
2 SwRhRL2b_contig_1762647 2162886007 Bacteria 207340
3 rootH2_10211777 3300003320 Unclassified 1761
4 rootL2_10181104 3300003322 Unclassified 3399
5 Ga0065704_10070151 3300005289 Bacteria 259038
6 Ga0065704_10077183 3300005289 Bacteria 4826
7 Ga0065712_10076387 3300005290 Bacteria 3665
8 Ga0065712_10082221 3300005290 Bacteria 2936
9 Ga0065712_10091651 3300005290 Bacteria 2364
10 Ga0070658_10254500 3300005327 Bacteria 1490
11 Ga0070683_100142597 3300005329 Unclassified 2270
12 Ga0070683_100510703 3300005329 Bacteria 1148
13 Ga0070670_100012327 3300005331 Bacteria 7314
14 Ga0070670_100046741 3300005331 Bacteria 3723
15 Ga0070670_100064094 3300005331 Bacteria 3154
16 Ga0068868_100128259 3300005338 Bacteria 2074
17 Ga0070660_100014527 3300005339 Bacteria 5676
18 Ga0070675_100092864 3300005354 Bacteria 2530
19 Ga0070674_100032350 3300005356 Bacteria 3473
20 Ga0070659_100025058 3300005366 Bacteria 4579
21 Ga0070706_100334977 3300005467 Bacteria 1411
22 Ga0070699_100079532 3300005518 Bacteria 2856
23 Ga0070679_100147640 3300005530 Bacteria 2329
24 Ga0070684_100000979 3300005535 Bacteria 20363
25 Ga0068855_100057170 3300005563 Bacteria 4573
26 Ga0068855_100078121 3300005563 Bacteria 3840
27 Ga0068855_100127060 3300005563 Unclassified 2914
28 Ga0068854_100161376 3300005578 Unclassified 1736
29 Ga0068856_100114614 3300005614 Bacteria 2695
30 Ga0068864_100111482 3300005618 Bacteria 2437
31 Ga0075362_10171341 3300006177 Bacteria 1049
32 Ga0105251_10000021 3300009011 Bacteria 137955
33 Ga0105240_10095562 3300009093 Bacteria 3623
34 Ga0111539_10001677 3300009094 Bacteria 29534
35 Ga0114129_10003180 3300009147 Bacteria 23033
36 Ga0114129_10651465 3300009147 Bacteria 1359
37 Ga0105249_10028082 3300009553 Bacteria 5079
38 Ga0157373_10003781 3300013100 Bacteria 11453
39 Ga0157373_10016698 3300013100 Bacteria 5349
40 Ga0157373_10096734 3300013100 Bacteria 2078
41 Ga0157371_10001267 3300013102 Bacteria 26607
42 Ga0157371_10006910 3300013102 Bacteria 9261
43 Ga0157371_10012801 3300013102 Bacteria 6395
44 Ga0157371_10051980 3300013102 Bacteria 2911
45 Ga0157370_10000026 3300013104 Bacteria 152092
46 Ga0157370_10003208 3300013104 Bacteria 19331
47 Ga0157370_10009661 3300013104 Bacteria 10258
48 Ga0157370_10107457 3300013104 Unclassified 2610
49 Ga0157370_10201276 3300013104 Bacteria 1847
50 Ga0157374_10241656 3300013296 Bacteria 1776
51 Ga0163162_10014517 3300013306 Bacteria 7697
52 Ga0157372_10012863 3300013307 Bacteria 8921
53 Ga0157372_10062389 3300013307 Bacteria 4176
54 Ga0157372_10062782 3300013307 Bacteria 4163
55 Ga0157372_10405649 3300013307 Bacteria 1588
56 Ga0157372_10423320 3300013307 Bacteria 1552
57 Ga0157372_10637268 3300013307 Bacteria 1241
58 Ga0157372_10717780 3300013307 Bacteria 1163
59 Ga0157372_11096344 3300013307 Unclassified 921
60 Ga0157372_11261014 3300013307 Unclassified 853
61 Ga0157380_10001149 3300014326 Bacteria 17091
62 Ga0157380_10527347 3300014326 Bacteria 1153
63 Ga0207713_1000003 3300025735 Bacteria 860698
64 Ga0207647_10065012 3300025904 Unclassified 2215
65 Ga0207695_10086978 3300025913 Bacteria 3150
66 Ga0207660_10142881 3300025917 Unclassified 1831
67 Ga0207657_10059452 3300025919 Bacteria 3283
68 Ga0207652_10053907 3300025921 Bacteria 3455
69 Ga0207652_10585304 3300025921 Unclassified 1001
70 Ga0207650_10083499 3300025925 Bacteria 2426
71 Ga0207690_10065488 3300025932 Bacteria 2485
72 Ga0207669_10072582 3300025937 Bacteria 2168
73 Ga0207661_10054145 3300025944 Unclassified 3214
74 Ga0207661_10355542 3300025944 Bacteria 1322
75 Ga0207661_10462478 3300025944 Bacteria 1156
76 Ga0207667_10001143 3300025949 Bacteria 33339
77 Ga0207667_10080453 3300025949 Bacteria 3376
78 Ga0207712_10025168 3300025961 Bacteria 3952
79 Ga0207678_10057869 3300026067 Unclassified 3336
80 Ga0207676_10119118 3300026095 Bacteria 2223
81 Ga0207675_100410132 3300026118 Bacteria 1336
82 Ga0207428_10058699 3300027907 Bacteria 3052
83 Ga0307413_10103744 3300031824 Bacteria 1886
84 Ga0307411_10039529 3300032005 Bacteria 2985
85 Ga0395899_0015243 3300037312 Bacteria 5859
86 Ga0395899_0084279 3300037312 Bacteria 2310
87 Ga0395899_0092882 3300037312 Bacteria 2184
88 Ga0395900_0065801 3300037418 Bacteria 3724
89 Ga0395900_0114143 3300037418 Bacteria 2772
90 Ga0395900_0215894 3300037418 Unclassified 1935
91 Ga0395898_0022161 3300037466 Bacteria 6435
92 Ga0395898_0062385 3300037466 Bacteria 3619
93 Ga0395898_0403404 3300037466 Bacteria 1303
94 Ga0395898_0476578 3300037466 Unclassified 1187
95 Ga0395905_0049092 3300037471 Unclassified 3954
96 Ga0395905_0224102 3300037471 Unclassified 1759
97 Ga0395901_0010896 3300038443 Bacteria 9215
98 Ga0395901_0072112 3300038443 Bacteria 3599
99 Ga0451843_0475855 3300041509 Bacteria 2192
100 Ga0439431_0006069 3300041997 Bacteria 2668
101 Ga0439445_0034966 3300042004 Bacteria 1318
102 Ga0450894_020807 3300042131 Bacteria 885
103 Ga0450896_002709 3300042133 Bacteria 2308
104 Ga0450899_007516 3300042135 Bacteria 1188
105 Ga0450918_012608 3300042531 Bacteria 1473
106 Ga0451577_0000647 3300042876 Bacteria 55383
107 Ga0453684_0001534 3300044712 Bacteria 64568
108 Ga0453684_0041862 3300044712 Bacteria 6185
109 Ga0466960_0224821 3300044901 Bacteria 1034
110 Ga0451576_0144189 3300045051 Bacteria 2483
111 Ga0495606_0196365 3300046507 Bacteria 1153
112 Ga0495643_0000926 3300046522 Bacteria 30682
113 Ga0495625_0010934 3300046660 Bacteria 7452
114 Ga0495660_0191904 3300046810 Bacteria 981
115 Ga0496106_0186125 3300048909 Bacteria 1650
116 Ga0496110_0412730 3300048913 Bacteria 1231
117 Ga0496115_0038265 3300048918 Bacteria 3806
118 Ga0496119_0006320 3300048922 Bacteria 11029
119 Ga0496120_0004806 3300048923 Bacteria 11067
120 Ga0496124_0009505 3300048927 Bacteria 10004
121 Ga0496125_0000173 3300048928 Bacteria 144726
122 Ga0496125_0012289 3300048928 Bacteria 8508
123 Ga0496126_0062813 3300048929 Bacteria 3331
124 Ga0501034_0010295 3300049571 Bacteria 9749
125 Ga0501034_0018671 3300049571 Bacteria 7107
126 Ga0501034_0089323 3300049571 Bacteria 3079
127 Ga0501040_0265553 3300049576 Bacteria 1225
128 Ga0501041_0059142 3300049577 Bacteria 2346
129 Ga0501074_0039896 3300049590 Bacteria 3400
130 Ga0501075_0194301 3300049591 Bacteria 1548
131 Ga0501076_0205466 3300049592 Bacteria 1609
132 Ga0501238_004784 3300049671 Bacteria 1704
133 Ga0501219_000134 3300049703 Bacteria 13088
134 Ga0501284_00063 3300050005 Bacteria 36768
135 nmdc:mga05p37_162168_c1 3300050507 Bacteria 2730
136 nmdc:mga08y16_9915_c1 3300050511 Bacteria 10000
137 Ga0500641_0001362 3300053096 Bacteria 8692
138 Ga0500616_0011130 3300053153 Bacteria 5340
139 Ga0501084_0258884 3300054114 Bacteria 1469
140 Ga0530510_0310828 3300061734 Bacteria 1180
141 2511234418 2511231000 Bacteria 4488346
142 2555257703 2554235234 Bacteria 5762085
143 2585159917 2582581281 Bacteria 4487904
144 2585164132 2582581282 Bacteria 4495830
145 2738699627 2738541273 Bacteria 4048577
146 2739253376 2738543014 Bacteria 4048139
147 2881248256 2881247448 Bacteria 3717788
148 2883068067 2883068021 Bacteria 6192739
149 2896088548 2896085136 Bacteria 6129793
150 2896110585 2896109856 Bacteria 7140722
151 2919108917 2919108558 Bacteria 5897419
152 2919512342 2919509842 Bacteria 4104664
153 2971823478 2971820967 Bacteria 5823634
154 2984574639 2984572630 Bacteria 4186940
155 2984608090 2984606641 Bacteria 4186971
156 Ga0501034_0200631
157 SwRhRL2b_contig_1762647
158 rootH2_10211777
159 rootL2_10181104
160 Ga0065704_10070151
161 Ga0065704_10077183
162 Ga0065712_10076387
163 Ga0065712_10082221
164 Ga0065712_10091651
165 Ga0070658_10254500
166 Ga0070683_100142597
167 Ga0070683_100510703
168 Ga0070670_100012327
169 Ga0070670_100046741
170 Ga0070670_100064094
171 Ga0068868_100128259
172 Ga0070660_100014527
173 Ga0070675_100092864
174 Ga0070674_100032350
175 Ga0070659_100025058
176 Ga0070706_100334977
177 Ga0070699_100079532
178 Ga0070679_100147640
179 Ga0070684_100000979
180 Ga0068855_100057170
181 Ga0068855_100078121
182 Ga0068855_100127060
183 Ga0068854_100161376
184 Ga0068856_100114614
185 Ga0068864_100111482
186 Ga0075362_10171341
187 Ga0105251_10000021
188 Ga0105240_10095562
189 Ga0111539_10001677
190 Ga0114129_10003180
191 Ga0114129_10651465
192 Ga0105249_10028082
193 Ga0157373_10003781
194 Ga0157373_10016698
195 Ga0157373_10096734
196 Ga0157371_10001267
197 Ga0157371_10006910
198 Ga0157371_10012801
199 Ga0157371_10051980
200 Ga0157370_10000026
201 Ga0157370_10003208
202 Ga0157370_10009661
203 Ga0157370_10107457
204 Ga0157370_10201276
205 Ga0157374_10241656
206 Ga0163162_10014517
207 Ga0157372_10012863
208 Ga0157372_10062389
209 Ga0157372_10062782
210 Ga0157372_10405649
211 Ga0157372_10423320
212 Ga0157372_10637268
213 Ga0157372_10717780
214 Ga0157372_11096344
215 Ga0157372_11261014
216 Ga0157380_10001149
217 Ga0157380_10527347
218 Ga0207713_1000003
219 Ga0207647_10065012
220 Ga0207695_10086978
221 Ga0207660_10142881
222 Ga0207657_10059452
223 Ga0207652_10053907
224 Ga0207652_10585304
225 Ga0207650_10083499
226 Ga0207690_10065488
227 Ga0207669_10072582
228 Ga0207661_10054145
229 Ga0207661_10355542
230 Ga0207661_10462478
231 Ga0207667_10001143
232 Ga0207667_10080453
233 Ga0207712_10025168
234 Ga0207678_10057869
235 Ga0207676_10119118
236 Ga0207675_100410132
237 Ga0207428_10058699
238 Ga0307413_10103744
239 Ga0307411_10039529
240 Ga0395899_0015243
241 Ga0395899_0084279
242 Ga0395899_0092882
243 Ga0395900_0065801
244 Ga0395900_0114143
245 Ga0395900_0215894
246 Ga0395898_0022161
247 Ga0395898_0062385
248 Ga0395898_0403404
249 Ga0395898_0476578
250 Ga0395905_0049092
251 Ga0395905_0224102
252 Ga0395901_0010896
253 Ga0395901_0072112
254 Ga0451843_0475855
255 Ga0439431_0006069
256 Ga0439445_0034966
257 Ga0450894_020807
258 Ga0450896_002709
259 Ga0450899_007516
260 Ga0450918_012608
261 Ga0451577_0000647
262 Ga0453684_0001534
263 Ga0453684_0041862
264 Ga0466960_0224821
265 Ga0451576_0144189
266 Ga0495606_0196365
267 Ga0495643_0000926
268 Ga0495625_0010934
269 Ga0495660_0191904
270 Ga0496106_0186125
271 Ga0496110_0412730
272 Ga0496115_0038265
273 Ga0496119_0006320
274 Ga0496120_0004806
275 Ga0496124_0009505
276 Ga0496125_0000173
277 Ga0496125_0012289
278 Ga0496126_0062813
279 Ga0501034_0010295
280 Ga0501034_0018671
281 Ga0501034_0089323
282 Ga0501040_0265553
283 Ga0501041_0059142
284 Ga0501074_0039896
285 Ga0501075_0194301
286 Ga0501076_0205466
287 Ga0501238_004784
288 Ga0501219_000134
289 Ga0501284_00063
290 nmdc:mga05p37_162168_c1
291 nmdc:mga08y16_9915_c1
292 Ga0500641_0001362
293 Ga0500616_0011130
294 Ga0501084_0258884
295 Ga0530510_0310828
296 2511234418
297 2555257703
298 2585159917
299 2585164132
300 2738699627
301 2739253376
302 2881248256
303 2883068067
304 2896088548
305 2896110585
306 2919108917
307 2919512342
308 2971823478
309 2984574639
310 2984608090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

16

221

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.4272 10 198
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3894 16 230
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3412 16 230
8j80-assembly1.cif.gz_B cryo-em structure of hznt7-fab complex in zinc state 1, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-unbound conformation 0.3386 10 208
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.3386 9 220
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7907 19 200 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7603 19 200 1.20.1250.20
af_A1A5C7_201_630_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4658 9 205 1.20.1250.20
af_Q8BH31_274_507_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4531 19 201 1.20.1250.20
af_Q5AAP8_275_455_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4445 18 201 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5C7Q869-F1-model_v4 deleted 0.8873 33 243
AF-A0A5C5V4K1-F1-model_v4 Integral membrane protein TerC family protein 0.8716 14 233 GO:0016020
AF-A0A432H6U7-F1-model_v4 TerC family protein 0.8655 24 233 GO:0005886
AF-A0A2K8XNZ1-F1-model_v4 TerC family protein 0.8615 8 230 GO:0016020
AF-A0A5M4D4V1-F1-model_v4 TerC family protein 0.8546 8 233 GO:0016020

Map