F222964

General Info

Members Datasets Scaffolds Average Seq Length
155 138 310 313

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0078675|Ga0495592_0078675_451_1485
Length 344
Sequence MDFGLVGAAGYVAPRHLRAIKAIGGCLKVAFDISDSVGILDSYFPSASFFTEFERFDRHVDLLRRTRQKIDYLSICSPNHLHDAHCRFALRSDIDAICEKPLVLNPWNLDGLTEIETATGRSISTILQLRLHPAIQNLKARIDAERDKAHNVDLTYIASRGRWYHTSWKGSEEKSGGVATNIGIHFFDVLVHVFGPVSVNIAHLHDAHRAAGFLVCGNAAIRWFVSIDCADLPESVNGKAAFRAITVDGEDMEFSEEFSELHTRSYEEIIAGRGFGVEAVRPSIEIVSALRRARIELHRGERHPFVAKHLTNLPMVPQKAARKSRPPKAFTVSDLAATDDQSMA

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
36 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
38 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
100 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
101 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
102 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
103 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
104 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
105 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
106 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
107 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
108 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
109 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
110 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
111 2643221596 Acidovorax sp. Root70 Isolate Unclassified
112 2643221651 Afipia sp. Root123D2 Isolate Unclassified
113 2643221652 Acidovorax sp. Root402 Isolate Unclassified
114 2643221734 Bosea sp. Root670 Isolate Unclassified
115 2643221736 Bosea sp. Root483D1 Isolate Unclassified
116 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
117 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
118 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
119 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
120 2904699407
121 2906610324
122 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
123 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
124 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
125 2922425934
126 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
127 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
128 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
129 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
130 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
131 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
132 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
133 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
134 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
135 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
136 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
137 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
138 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.58
Metatranscriptomes 0
Isolates 18.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.94
Nodule 10.97
Rhizoplane 1.29
Rhizosphere 51.61
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0078675 3300046454 Bacteria 2388
2 SwRhRL2b_contig_1521557 2162886007 Bacteria 2811
3 SwRhRL2b_contig_353934 2162886007 Bacteria 7751
4 JGI25159J45721_1001982 3300002987 Bacteria 8151
5 JGI25151J46595_10000015 3300003187 Bacteria 250420
6 JGI25153J46596_10001102 3300003215 Bacteria 16431
7 rootL2_10140140 3300003322 Bacteria 1734
8 rootH1_10324247 3300003323 Bacteria 1301
9 Ga0055531_10000048 3300003794 Bacteria 131142
10 Ga0065165_1001517 3300005262 Bacteria 24458
11 Ga0065704_10073152 3300005289 Bacteria 7528
12 Ga0070658_10013976 3300005327 Bacteria 6445
13 Ga0070668_100227668 3300005347 Bacteria 1540
14 Ga0070669_100022315 3300005353 Bacteria 4527
15 Ga0070709_10041769 3300005434 Bacteria 2828
16 Ga0070681_10162110 3300005458 Bacteria 2160
17 Ga0070679_100464453 3300005530 Bacteria 1210
18 Ga0068864_100312178 3300005618 Bacteria 1474
19 Ga0068860_100000714 3300005843 Bacteria 38006
20 Ga0081455_10010320 3300005937 Bacteria 9495
21 Ga0081540_1002070 3300005983 Bacteria 16720
22 Ga0075365_10012153 3300006038 Bacteria 5099
23 Ga0075363_100007405 3300006048 Bacteria 5043
24 Ga0070716_100152586 3300006173 Bacteria 1488
25 Ga0075367_10000954 3300006178 Bacteria 11785
26 Ga0075366_10082641 3300006195 Bacteria 1919
27 Ga0075370_10004636 3300006353 Bacteria 6710
28 Ga0068871_100304934 3300006358 Bacteria 1399
29 Ga0105251_10001480 3300009011 Bacteria 20156
30 Ga0105240_10289445 3300009093 Bacteria 1879
31 Ga0105247_10006959 3300009101 Bacteria 6965
32 Ga0114129_10770553 3300009147 Bacteria 1230
33 Ga0157373_10011210 3300013100 Bacteria 6595
34 Ga0157370_10082854 3300013104 Bacteria 3016
35 Ga0163161_10000730 3300017792 Bacteria 25867
36 Ga0214544_1010510 3300021320 Bacteria 13556
37 Ga0209148_1000641 3300025254 Bacteria 30490
38 Ga0209233_1006936 3300025261 Bacteria 3621
39 Ga0209455_1000973 3300025272 Bacteria 14484
40 Ga0209130_1000127 3300025284 Bacteria 123652
41 Ga0209130_1000739 3300025284 Bacteria 28635
42 Ga0209025_1000010 3300025294 Bacteria 986612
43 Ga0209025_1001376 3300025294 Bacteria 32636
44 Ga0209758_1007184 3300025297 Bacteria 7678
45 Ga0209257_1000007 3300025304 Bacteria 1564415
46 Ga0209257_1011167 3300025304 Bacteria 4374
47 Ga0207696_1002020 3300025711 Bacteria 10267
48 Ga0207655_1025589 3300025728 Bacteria 2860
49 Ga0207713_1004109 3300025735 Bacteria 9592
50 Ga0207710_10014642 3300025900 Bacteria 3310
51 Ga0207705_10008716 3300025909 Bacteria 7393
52 Ga0207707_10212151 3300025912 Bacteria 1686
53 Ga0207693_10068396 3300025915 Bacteria 2780
54 Ga0207709_10000073 3300025935 Bacteria 176109
55 Ga0207667_10157597 3300025949 Bacteria 2336
56 Ga0207651_10008727 3300025960 Bacteria 5496
57 Ga0207641_10226165 3300026088 Bacteria 1737
58 Ga0207676_10178120 3300026095 Bacteria 1859
59 Ga0209371_1000091 3300027312 Bacteria 172276
60 Ga0268264_10000096 3300028381 Bacteria 230188
61 Ga0268256_1000080 3300030500 Bacteria 172273
62 Ga0265325_10083321 3300031241 Bacteria 1586
63 Ga0307509_10089496 3300031507 Bacteria 3157
64 Ga0307509_10131482 3300031507 Bacteria 2458
65 Ga0307514_10000558 3300031649 Bacteria 71090
66 Ga0307516_10000127 3300031730 Bacteria 90180
67 Ga0315911_1000014 3300033442 Bacteria 207605
68 Ga0373927_0009742 3300035695 Bacteria 6441
69 Ga0373947_0116268 3300035725 Bacteria 1696
70 Ga0373925_0296035 3300037068 Bacteria 1306
71 Ga0395900_0206395 3300037418 Bacteria 1986
72 Ga0436363_0627336 3300039450 Bacteria 1343
73 Ga0451577_0016590 3300042876 Bacteria 6815
74 Ga0451577_0025660 3300042876 Bacteria 5346
75 Ga0451577_0060753 3300042876 Bacteria 3370
76 Ga0451577_0216991 3300042876 Bacteria 1729
77 Ga0453683_0000542 3300044673 Bacteria 42086
78 Ga0453683_0001732 3300044673 Bacteria 18100
79 Ga0453683_0003311 3300044673 Bacteria 11911
80 Ga0453684_0001723 3300044712 Bacteria 58623
81 Ga0453684_0074907 3300044712 Bacteria 4258
82 Ga0466959_0129881 3300045049 Bacteria 1786
83 Ga0451576_0001003 3300045051 Bacteria 52190
84 Ga0451576_0003923 3300045051 Bacteria 19854
85 Ga0451576_0004854 3300045051 Bacteria 17225
86 Ga0495580_0156121 3300046472 Bacteria 1580
87 Ga0495607_0002371 3300046501 Bacteria 15381
88 Ga0495663_0000195 3300046525 Bacteria 24215
89 Ga0495652_0015217 3300046529 Bacteria 6888
90 Ga0495645_0133815 3300046543 Bacteria 1735
91 Ga0495649_0000133 3300046694 Bacteria 65433
92 Ga0495604_0237427 3300047317 Unclassified 1248
93 Ga0495676_0000157 3300047321 Bacteria 52412
94 Ga0495602_0124227 3300048088 Bacteria 2071
95 Ga0496102_0080914 3300048905 Bacteria 2994
96 Ga0496104_0213014 3300048907 Bacteria 1844
97 Ga0496121_0002779 3300048924 Bacteria 25970
98 Ga0496126_0052161 3300048929 Bacteria 3719
99 Ga0496126_0073320 3300048929 Bacteria 3044
100 Ga0496126_0120447 3300048929 Bacteria 2277
101 Ga0501300_000175 3300049523 Bacteria 9664
102 Ga0501036_0277307 3300049572 Bacteria 1403
103 Ga0501037_0025044 3300049573 Bacteria 4410
104 Ga0501048_0126150 3300049582 Bacteria 1810
105 Ga0501073_0038950 3300049589 Bacteria 3370
106 Ga0501075_0058859 3300049591 Bacteria 2894
107 Ga0501077_0203982 3300049593 Bacteria 1256
108 Ga0501079_0065977 3300049741 Bacteria 2793
109 Ga0501262_000010 3300049759 Bacteria 32611
110 Ga0501044_0457587 3300049823 Bacteria 1182
111 nmdc:mga0yw44_2735_c1 3300050492 Bacteria 7627
112 nmdc:mga0k408_14925_c1 3300050493 Bacteria 4289
113 nmdc:mga0k408_77217_c1 3300050493 Bacteria 1947
114 nmdc:mga06z11_213873_c1 3300050494 Bacteria 1124
115 nmdc:mga07m45_1011_c1 3300050496 Bacteria 12428
116 nmdc:mga07m45_1125_c1 3300050496 Bacteria 11997
117 Ga0500593_000156 3300053117 Bacteria 27265
118 Ga0500595_003999 3300053119 Bacteria 6731
119 Ga0500607_000297 3300053121 Bacteria 47120
120 Ga0500608_001073 3300053122 Bacteria 9757
121 Ga0500652_000006 3300053131 Bacteria 167437
122 Ga0500568_0003844 3300053139 Bacteria 8194
123 Ga0500634_0000210 3300053161 Bacteria 18978
124 Ga0500636_0014000 3300053177 Bacteria 4714
125 2513862274 2513237137 Bacteria 9558895
126 2524535660 2524023228 Bacteria 10118060
127 2640736296 2639762793 Bacteria 3943681
128 2643993803 2643221596 Bacteria 5006805
129 2644287613 2643221651 Bacteria 4798932
130 2644293807 2643221652 Bacteria 5140275
131 2644736318 2643221734 Bacteria 5365412
132 2644745854 2643221736 Bacteria 6608466
133 2838058268 2838054893 Bacteria 7451788
134 2885194467 2885192300 Bacteria 5882526
135 2885376808 2885374607 Bacteria 8927485
136 2903754222 2903748898 Bacteria 9972761
137 2904705384
138 2906611071
139 2906641426 2906635258 Bacteria 8601019
140 2908744585 2908739725 Bacteria 8628932
141 2916179832 2916178963 Bacteria 5265078
142 2922428243
143 2935635925 2935630451 Bacteria 8169952
144 2936001677 2935992306 Bacteria 9802711
145 2941512556 2941507105 Bacteria 8166816
146 2941520257 2941515067 Bacteria 8166720
147 2941528347 2941523033 Bacteria 8169134
148 2945987748 2945984333 Bacteria 7358892
149 2990713439 2990710928 Bacteria 5002431
150 3005478228 3005474847 Bacteria 9259049
151 8006942990 8006933436 Bacteria 10410654
152 8006969801 8006964411 Bacteria 8966052
153 8006982710 8006973647 Bacteria 10679141
154 8056969075 8056967851 Bacteria 9038162
155 8057531976 8057529695 Bacteria 6306553
156 Ga0495592_0078675
157 SwRhRL2b_contig_1521557
158 SwRhRL2b_contig_353934
159 JGI25159J45721_1001982
160 JGI25151J46595_10000015
161 JGI25153J46596_10001102
162 rootL2_10140140
163 rootH1_10324247
164 Ga0055531_10000048
165 Ga0065165_1001517
166 Ga0065704_10073152
167 Ga0070658_10013976
168 Ga0070668_100227668
169 Ga0070669_100022315
170 Ga0070709_10041769
171 Ga0070681_10162110
172 Ga0070679_100464453
173 Ga0068864_100312178
174 Ga0068860_100000714
175 Ga0081455_10010320
176 Ga0081540_1002070
177 Ga0075365_10012153
178 Ga0075363_100007405
179 Ga0070716_100152586
180 Ga0075367_10000954
181 Ga0075366_10082641
182 Ga0075370_10004636
183 Ga0068871_100304934
184 Ga0105251_10001480
185 Ga0105240_10289445
186 Ga0105247_10006959
187 Ga0114129_10770553
188 Ga0157373_10011210
189 Ga0157370_10082854
190 Ga0163161_10000730
191 Ga0214544_1010510
192 Ga0209148_1000641
193 Ga0209233_1006936
194 Ga0209455_1000973
195 Ga0209130_1000127
196 Ga0209130_1000739
197 Ga0209025_1000010
198 Ga0209025_1001376
199 Ga0209758_1007184
200 Ga0209257_1000007
201 Ga0209257_1011167
202 Ga0207696_1002020
203 Ga0207655_1025589
204 Ga0207713_1004109
205 Ga0207710_10014642
206 Ga0207705_10008716
207 Ga0207707_10212151
208 Ga0207693_10068396
209 Ga0207709_10000073
210 Ga0207667_10157597
211 Ga0207651_10008727
212 Ga0207641_10226165
213 Ga0207676_10178120
214 Ga0209371_1000091
215 Ga0268264_10000096
216 Ga0268256_1000080
217 Ga0265325_10083321
218 Ga0307509_10089496
219 Ga0307509_10131482
220 Ga0307514_10000558
221 Ga0307516_10000127
222 Ga0315911_1000014
223 Ga0373927_0009742
224 Ga0373947_0116268
225 Ga0373925_0296035
226 Ga0395900_0206395
227 Ga0436363_0627336
228 Ga0451577_0016590
229 Ga0451577_0025660
230 Ga0451577_0060753
231 Ga0451577_0216991
232 Ga0453683_0000542
233 Ga0453683_0001732
234 Ga0453683_0003311
235 Ga0453684_0001723
236 Ga0453684_0074907
237 Ga0466959_0129881
238 Ga0451576_0001003
239 Ga0451576_0003923
240 Ga0451576_0004854
241 Ga0495580_0156121
242 Ga0495607_0002371
243 Ga0495663_0000195
244 Ga0495652_0015217
245 Ga0495645_0133815
246 Ga0495649_0000133
247 Ga0495604_0237427
248 Ga0495676_0000157
249 Ga0495602_0124227
250 Ga0496102_0080914
251 Ga0496104_0213014
252 Ga0496121_0002779
253 Ga0496126_0052161
254 Ga0496126_0073320
255 Ga0496126_0120447
256 Ga0501300_000175
257 Ga0501036_0277307
258 Ga0501037_0025044
259 Ga0501048_0126150
260 Ga0501073_0038950
261 Ga0501075_0058859
262 Ga0501077_0203982
263 Ga0501079_0065977
264 Ga0501262_000010
265 Ga0501044_0457587
266 nmdc:mga0yw44_2735_c1
267 nmdc:mga0k408_14925_c1
268 nmdc:mga0k408_77217_c1
269 nmdc:mga06z11_213873_c1
270 nmdc:mga07m45_1011_c1
271 nmdc:mga07m45_1125_c1
272 Ga0500593_000156
273 Ga0500595_003999
274 Ga0500607_000297
275 Ga0500608_001073
276 Ga0500652_000006
277 Ga0500568_0003844
278 Ga0500634_0000210
279 Ga0500636_0014000
280 2513862274
281 2524535660
282 2640736296
283 2643993803
284 2644287613
285 2644293807
286 2644736318
287 2644745854
288 2838058268
289 2885194467
290 2885376808
291 2903754222
292 2904705384
293 2906611071
294 2906641426
295 2908744585
296 2916179832
297 2922428243
298 2935635925
299 2936001677
300 2941512556
301 2941520257
302 2941528347
303 2945987748
304 2990713439
305 3005478228
306 8006942990
307 8006969801
308 8006982710
309 8056969075
310 8057531976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

1

126

0.91

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

148

223

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa2-assembly1.cif.gz_A crystal structure of the wlba (wbpb) dehydrogenase from pseudomonas aeruginosa in complex with nad at 1.5 angstrom resolution 0.9641 1 310
3oa0-assembly1.cif.gz_D crystal structure of the wlba (wbpb) dehydrogenase from thermus thermophilus in complex with nad and udp-glcnaca 0.9587 1 308
3oa2-assembly1.cif.gz_A crystal structure of the wlba (wbpb) dehydrogenase from pseudomonas aeruginosa in complex with nad at 1.5 angstrom resolution 0.9579 1 310
3oa2-assembly1.cif.gz_D crystal structure of the wlba (wbpb) dehydrogenase from pseudomonas aeruginosa in complex with nad at 1.5 angstrom resolution 0.9568 1 309
3oa2-assembly1.cif.gz_C crystal structure of the wlba (wbpb) dehydrogenase from pseudomonas aeruginosa in complex with nad at 1.5 angstrom resolution 0.9558 1 309
ID Description Score Start End Superfamily
3o9zC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9771 1 127 3.40.50.720
3o9zC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9478 1 127 3.40.50.720
3o9zC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9368 133 310 3.30.360.10
3oa2D02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9364 133 309 3.30.360.10
3o9zC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9169 133 310 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A6N7ZQW5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9714 1 313 GO:0000166
AF-A0A7X7P1G6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9712 1 311 GO:0000166
AF-A0A7X7P1G6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.962 1 311 GO:0000166
AF-A0A836VB36-F1-model_v4 Oxidoreductase 0.9601 131 311
AF-A0A6N7ZQW5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9563 1 313 GO:0000166

Map