F222564

General Info

Members Datasets Scaffolds Average Seq Length
155 95 154 466

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10000075|Ga0265338_1000007535
Length 503
Sequence MPTTLSKTRHLISSRSVSAFNLRLCLPAPLRYNNLMPMKKRSPVSRSGRFAHDVSADVAQFTQSISFDARLWRHDILGSLAHAEMLRAIGVLTKQECTAIVRCLDAIGKDIKAGKFKWNPALEDVHMNIEAELTRRIPAGAKLHTGRSRNDQVALDVRLWLRDEITILLGTIADLQRALVSLGEKNADVLIPGYTHLQRAQPVYLAHHLLAYVEMLERDCERLWDCHSRVNICPLGSGAIAGSTLPLKRELVAKLLNFVDANGKVQVTQNSMDAVSDRDFAVEFCAAGALLAVHLSRLSEDIILWASAEFNFIKIGDAYTTGSSLMPQKKNPDIAELTRGKSARVIGNLVSLLTLLKGLPMTYNRDLQEDKERLFDTADTVGACTRLMAAMLRNTKVNRTACLHAASDPALLATDLADYLVRKGMPFRHAHHVVGAVVALAEQSGKRLNFLTLAELQSVDKTFGRDALGVFDLLRAMSKRNLTGAPGTKEVAKQLARWREQLS

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
56 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
57 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
58 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
59 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
60 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
61 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
64 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.29
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10076545 3300003320 Bacteria 2233
2 Ga0070690_100002132 3300005330 Bacteria 10571
3 Ga0070714_100007987 3300005435 Bacteria 8245
4 Ga0070700_100107614 3300005441 Bacteria 1848
5 Ga0070681_10040591 3300005458 Bacteria 4661
6 Ga0070681_10074012 3300005458 Bacteria 3368
7 Ga0070665_100000005 3300005548 Bacteria 734905
8 Ga0068855_100077007 3300005563 Bacteria 3870
9 Ga0068855_100258549 3300005563 Bacteria 1940
10 Ga0068856_100000172 3300005614 Bacteria 67506
11 Ga0068856_100051493 3300005614 Bacteria 4059
12 Ga0068859_100053304 3300005617 Bacteria 4068
13 Ga0068864_100207724 3300005618 Bacteria 1802
14 Ga0068863_100007238 3300005841 Bacteria 10876
15 Ga0068858_100115902 3300005842 Bacteria 2504
16 Ga0075431_100068815 3300006847 Bacteria 3653
17 Ga0097620_100053305 3300006931 Bacteria 4068
18 Ga0105240_10012859 3300009093 Bacteria 11532
19 Ga0105240_10019399 3300009093 Bacteria 9086
20 Ga0105240_10022929 3300009093 Bacteria 8270
21 Ga0105240_10119847 3300009093 Bacteria 3169
22 Ga0105240_10145626 3300009093 Bacteria 2827
23 Ga0111539_10034547 3300009094 Bacteria 6130
24 Ga0105247_10046758 3300009101 Bacteria 2657
25 Ga0105248_10238177 3300009177 Bacteria 2049
26 Ga0105238_10028592 3300009551 Bacteria 5679
27 Ga0157370_10097932 3300013104 Bacteria 2751
28 Ga0157375_10290929 3300013308 Bacteria 1797
29 Ga0163163_10000345 3300014325 Bacteria 44677
30 Ga0213872_10033720 3300021361 Bacteria 2347
31 Ga0207707_10043964 3300025912 Bacteria 3895
32 Ga0207707_10075247 3300025912 Bacteria 2945
33 Ga0207695_10008387 3300025913 Bacteria 12943
34 Ga0207695_10133675 3300025913 Bacteria 2436
35 Ga0207671_10111975 3300025914 Bacteria 2077
36 Ga0207652_10022594 3300025921 Bacteria 5205
37 Ga0207694_10094270 3300025924 Bacteria 2365
38 Ga0207664_10005769 3300025929 Bacteria 8470
39 Ga0207667_10143721 3300025949 Bacteria 2456
40 Ga0207702_10004142 3300026078 Bacteria 12999
41 Ga0207702_10012251 3300026078 Bacteria 7136
42 Ga0207702_10130444 3300026078 Bacteria 2261
43 Ga0207702_10168958 3300026078 Bacteria 2003
44 Ga0207641_10019254 3300026088 Bacteria 5601
45 Ga0207676_10085143 3300026095 Bacteria 2579
46 Ga0207674_10215946 3300026116 Bacteria 1866
47 Ga0268266_10000012 3300028379 Bacteria 734912
48 Ga0265337_1000147 3300028556 Bacteria 35245
49 Ga0265337_1000662 3300028556 Bacteria 18144
50 Ga0265337_1011086 3300028556 Bacteria 3122
51 Ga0265326_10004579 3300028558 Bacteria 4419
52 Ga0265319_1000003 3300028563 Bacteria 340561
53 Ga0265319_1015763 3300028563 Bacteria 2917
54 Ga0265334_10005545 3300028573 Bacteria 5512
55 Ga0265334_10007739 3300028573 Bacteria 4604
56 Ga0265323_10000461 3300028653 Bacteria 23032
57 Ga0265336_10000289 3300028666 Bacteria 34559
58 Ga0265336_10007637 3300028666 Bacteria 3838
59 Ga0265336_10023043 3300028666 Bacteria 1978
60 Ga0265338_10000050 3300028800 Bacteria 213659
61 Ga0265338_10000075 3300028800 Bacteria 180334
62 Ga0265338_10000088 3300028800 Bacteria 174641
63 Ga0265338_10000111 3300028800 Bacteria 151469
64 Ga0265338_10000399 3300028800 Bacteria 77917
65 Ga0265338_10001952 3300028800 Bacteria 32165
66 Ga0265338_10002179 3300028800 Bacteria 30072
67 Ga0265338_10002760 3300028800 Bacteria 25721
68 Ga0265338_10003142 3300028800 Bacteria 23576
69 Ga0265338_10010696 3300028800 Bacteria 10716
70 Ga0265338_10011698 3300028800 Bacteria 10103
71 Ga0265338_10024988 3300028800 Bacteria 6082
72 Ga0265338_10058244 3300028800 Bacteria 3411
73 Ga0265338_10078658 3300028800 Bacteria 2780
74 Ga0265338_10087094 3300028800 Bacteria 2596
75 Ga0265338_10158189 3300028800 Bacteria 1752
76 Ga0265324_10000532 3300029957 Bacteria 26132
77 Ga0265324_10000581 3300029957 Bacteria 24955
78 Ga0265324_10003337 3300029957 Bacteria 7694
79 Ga0265324_10006625 3300029957 Bacteria 4796
80 Ga0265324_10009487 3300029957 Bacteria 3796
81 Ga0307511_10000422 3300030521 Bacteria 45244
82 Ga0265332_10025654 3300031238 Bacteria 2587
83 Ga0265320_10001242 3300031240 Bacteria 18711
84 Ga0265320_10002026 3300031240 Bacteria 14284
85 Ga0265320_10003974 3300031240 Bacteria 9754
86 Ga0265320_10030729 3300031240 Bacteria 2766
87 Ga0265320_10039146 3300031240 Bacteria 2372
88 Ga0265325_10021890 3300031241 Bacteria 3506
89 Ga0265340_10005475 3300031247 Bacteria 7050
90 Ga0265340_10057593 3300031247 Bacteria 1867
91 Ga0265339_10016223 3300031249 Bacteria 4446
92 Ga0265331_10060255 3300031250 Bacteria 1793
93 Ga0265327_10001054 3300031251 Bacteria 38537
94 Ga0265327_10008483 3300031251 Bacteria 7641
95 Ga0265327_10029399 3300031251 Bacteria 3127
96 Ga0265316_10001020 3300031344 Bacteria 30389
97 Ga0265316_10004099 3300031344 Bacteria 14594
98 Ga0265316_10039677 3300031344 Bacteria 3780
99 Ga0265316_10057520 3300031344 Bacteria 3032
100 Ga0265316_10069627 3300031344 Bacteria 2715
101 Ga0265313_10014725 3300031595 Bacteria 4602
102 Ga0373928_0001225 3300035084 Bacteria 5052
103 Ga0373929_0000988 3300035085 Bacteria 5518
104 Ga0373944_0000050 3300035089 Bacteria 19068
105 Ga0373949_0002335 3300035090 Bacteria 4927
106 Ga0373951_0000454 3300035091 Bacteria 11880
107 Ga0373932_0000004 3300035112 Bacteria 412176
108 Ga0373939_0014469 3300035114 Bacteria 2048
109 Ga0373954_0002170 3300035118 Bacteria 8155
110 Ga0373946_0011530 3300035171 Bacteria 3300
111 Ga0373962_0000044 3300035242 Bacteria 28425
112 Ga0373931_0000018 3300035691 Bacteria 190282
113 Ga0373927_0006378 3300035695 Bacteria 8036
114 Ga0373927_0009238 3300035695 Bacteria 6613
115 Ga0373933_0028341 3300035724 Bacteria 3230
116 Ga0373947_0007031 3300035725 Bacteria 6523
117 Ga0373947_0039620 3300035725 Bacteria 2804
118 Ga0373937_0005678 3300036401 Bacteria 10710
119 Ga0373937_0178856 3300036401 Bacteria 1992
120 Ga0373925_0001624 3300037068 Bacteria 18992
121 Ga0373925_0006037 3300037068 Bacteria 8962
122 Ga0436361_1047828 3300039447 Bacteria 2754
123 Ga0451577_0020148 3300042876 Bacteria 6124
124 Ga0451577_0280002 3300042876 Bacteria 1511
125 Ga0466969_0008571 3300044656 Bacteria 5425
126 Ga0453684_0005590 3300044712 Bacteria 24767
127 Ga0453684_0184304 3300044712 Bacteria 2448
128 Ga0453684_0219416 3300044712 Bacteria 2204
129 Ga0451576_0102385 3300045051 Bacteria 2979
130 Ga0495592_0081110 3300046454 Bacteria 2346
131 Ga0495641_0031338 3300046461 Bacteria 2542
132 Ga0495628_0142873 3300046516 Bacteria 1826
133 Ga0495586_0000477 3300046535 Bacteria 23932
134 Ga0495586_0001258 3300046535 Bacteria 14228
135 Ga0495586_0124611 3300046535 Bacteria 1441
136 Ga0495645_0188828 3300046543 Bacteria 1406
137 Ga0495634_0005142 3300046642 Bacteria 10102
138 Ga0495657_0019573 3300046675 Bacteria 4883
139 Ga0495613_0001737 3300046689 Bacteria 16578
140 Ga0495613_0044493 3300046689 Bacteria 3284
141 Ga0495674_0074017 3300047319 Bacteria 2935
142 Ga0495680_0004846 3300047322 Bacteria 12761
143 Ga0496115_0002172 3300048918 Bacteria 14041
144 Ga0501031_0000759 3300049568 Bacteria 19439
145 Ga0501032_0011238 3300049569 Bacteria 6430
146 Ga0501033_0003433 3300049570 Bacteria 13032
147 Ga0501035_0004226 3300049822 Bacteria 13641
148 Ga0501035_0028355 3300049822 Bacteria 5111
149 Ga0501044_0002708 3300049823 Bacteria 20135
150 Ga0501044_0040414 3300049823 Bacteria 4860
151 nmdc:mga06r32_45218_c1 3300050510 Bacteria 4196
152 nmdc:mga08y16_244283_c1 3300050511 Bacteria 1855
153 Ga0495601_0039135 3300053077 Bacteria 2969
154 Ga0500555_000020 3300053103 Bacteria 172742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0102385 Ga0451576_0102385_44_1315 404
2 3300046543 Ga0495645_0188828 Ga0495645_0188828_116_1396 419
3 3300005563 Ga0068855_100258549 Ga0068855_1002585491 424
4 3300046535 Ga0495586_0124611 Ga0495586_0124611_140_1417 424
5 3300009101 Ga0105247_10046758 Ga0105247_100467582 444
6 3300026095 Ga0207676_10085143 Ga0207676_100851432 444
7 3300005618 Ga0068864_100207724 Ga0068864_1002077242 445
8 3300046461 Ga0495641_0031338 Ga0495641_0031338_401_1744 446
9 3300046516 Ga0495628_0142873 Ga0495628_0142873_333_1673 446
10 3300046535 Ga0495586_0001258 Ga0495586_0001258_7779_9122 446
11 3300046689 Ga0495613_0044493 Ga0495613_0044493_961_2304 446
12 3300053077 Ga0495601_0039135 Ga0495601_0039135_677_2017 446
13 3300025913 Ga0207695_10133675 Ga0207695_101336752 448
14 3300042876 Ga0451577_0280002 Ga0451577_0280002_11_1438 449
15 iso_pu_bacteria 2786546517 2787437661 449
16 3300028573 Ga0265334_10005545 Ga0265334_100055457 452
17 3300009093 Ga0105240_10022929 Ga0105240_100229296 453
18 3300009177 Ga0105248_10238177 Ga0105248_102381772 453
19 3300028800 Ga0265338_10078658 Ga0265338_100786583 454
20 3300044712 Ga0453684_0219416 Ga0453684_0219416_608_2017 454
21 3300005441 Ga0070700_100107614 Ga0070700_1001076142 457
22 3300009093 Ga0105240_10145626 Ga0105240_101456263 457
23 3300013308 Ga0157375_10290929 Ga0157375_102909292 457
24 3300030521 Ga0307511_10000422 Ga0307511_1000042210 457
25 3300005548 Ga0070665_100000005 Ga0070665_100000005597 459
26 3300005841 Ga0068863_100007238 Ga0068863_10000723812 459
27 3300006847 Ga0075431_100068815 Ga0075431_1000688153 459
28 3300021361 Ga0213872_10033720 Ga0213872_100337202 459
29 3300025913 Ga0207695_10008387 Ga0207695_100083878 459
30 3300025914 Ga0207671_10111975 Ga0207671_101119752 459
31 3300026088 Ga0207641_10019254 Ga0207641_100192543 459
32 3300028379 Ga0268266_10000012 Ga0268266_1000001255 459
33 3300039447 Ga0436361_1047828 Ga0436361_1047828_1052_2470 459
34 3300044656 Ga0466969_0008571 Ga0466969_0008571_1293_2711 459
35 3300050510 nmdc:mga06r32_45218_c1 nmdc:mga06r32_45218_c1_2110_3507 459
36 3300053103 Ga0500555_000020 Ga0500555_000020_151304_152698 459
37 3300029957 Ga0265324_10006625 Ga0265324_100066252 464
38 3300003320 rootH2_10076545 rootH2_100765452 465
39 3300005330 Ga0070690_100002132 Ga0070690_1000021325 465
40 3300005435 Ga0070714_100007987 Ga0070714_1000079876 465
41 3300005458 Ga0070681_10040591 Ga0070681_100405913 465
42 3300005458 Ga0070681_10074012 Ga0070681_100740124 465
43 3300005563 Ga0068855_100077007 Ga0068855_1000770073 465
44 3300005614 Ga0068856_100000172 Ga0068856_10000017241 465
45 3300005614 Ga0068856_100051493 Ga0068856_1000514932 465
46 3300005617 Ga0068859_100053304 Ga0068859_1000533043 465
47 3300005842 Ga0068858_100115902 Ga0068858_1001159022 465
48 3300006931 Ga0097620_100053305 Ga0097620_1000533052 465
49 3300009093 Ga0105240_10012859 Ga0105240_100128597 465
50 3300009093 Ga0105240_10019399 Ga0105240_100193998 465
51 3300009093 Ga0105240_10119847 Ga0105240_101198473 465
52 3300009094 Ga0111539_10034547 Ga0111539_100345475 465
53 3300009551 Ga0105238_10028592 Ga0105238_100285923 465
54 3300013104 Ga0157370_10097932 Ga0157370_100979322 465
55 3300014325 Ga0163163_10000345 Ga0163163_100003456 465
56 3300025912 Ga0207707_10043964 Ga0207707_100439643 465
57 3300025912 Ga0207707_10075247 Ga0207707_100752473 465
58 3300025921 Ga0207652_10022594 Ga0207652_100225943 465
59 3300025924 Ga0207694_10094270 Ga0207694_100942702 465
60 3300025929 Ga0207664_10005769 Ga0207664_100057693 465
61 3300025949 Ga0207667_10143721 Ga0207667_101437211 465
62 3300026078 Ga0207702_10004142 Ga0207702_100041427 465
63 3300026078 Ga0207702_10012251 Ga0207702_100122512 465
64 3300026078 Ga0207702_10130444 Ga0207702_101304442 465
65 3300026078 Ga0207702_10168958 Ga0207702_101689581 465
66 3300026116 Ga0207674_10215946 Ga0207674_102159461 465
67 3300028556 Ga0265337_1000147 Ga0265337_100014730 465
68 3300028556 Ga0265337_1000662 Ga0265337_100066210 465
69 3300028556 Ga0265337_1011086 Ga0265337_10110864 465
70 3300028558 Ga0265326_10004579 Ga0265326_100045794 465
71 3300028563 Ga0265319_1000003 Ga0265319_1000003326 465
72 3300028563 Ga0265319_1015763 Ga0265319_10157632 465
73 3300028573 Ga0265334_10007739 Ga0265334_100077395 465
74 3300028653 Ga0265323_10000461 Ga0265323_100004617 465
75 3300028666 Ga0265336_10000289 Ga0265336_100002896 465
76 3300028666 Ga0265336_10007637 Ga0265336_100076373 465
77 3300028666 Ga0265336_10023043 Ga0265336_100230431 465
78 3300028800 Ga0265338_10000050 Ga0265338_1000005034 465
79 3300028800 Ga0265338_10000075 Ga0265338_1000007535 465
80 3300028800 Ga0265338_10000088 Ga0265338_1000008870 465
81 3300028800 Ga0265338_10000111 Ga0265338_100001112 465
82 3300028800 Ga0265338_10000399 Ga0265338_1000039963 465
83 3300028800 Ga0265338_10001952 Ga0265338_1000195213 465
84 3300028800 Ga0265338_10002179 Ga0265338_1000217910 465
85 3300028800 Ga0265338_10002760 Ga0265338_1000276018 465
86 3300028800 Ga0265338_10003142 Ga0265338_1000314222 465
87 3300028800 Ga0265338_10010696 Ga0265338_1001069611 465
88 3300028800 Ga0265338_10011698 Ga0265338_100116984 465
89 3300028800 Ga0265338_10024988 Ga0265338_100249885 465
90 3300028800 Ga0265338_10058244 Ga0265338_100582443 465
91 3300028800 Ga0265338_10087094 Ga0265338_100870942 465
92 3300028800 Ga0265338_10158189 Ga0265338_101581892 465
93 3300029957 Ga0265324_10000532 Ga0265324_100005323 465
94 3300029957 Ga0265324_10000581 Ga0265324_1000058116 465
95 3300029957 Ga0265324_10003337 Ga0265324_100033375 465
96 3300029957 Ga0265324_10009487 Ga0265324_100094873 465
97 3300031238 Ga0265332_10025654 Ga0265332_100256542 465
98 3300031240 Ga0265320_10001242 Ga0265320_1000124220 465
99 3300031240 Ga0265320_10002026 Ga0265320_1000202610 465
100 3300031240 Ga0265320_10003974 Ga0265320_100039747 465
101 3300031240 Ga0265320_10030729 Ga0265320_100307291 465
102 3300031240 Ga0265320_10039146 Ga0265320_100391461 465
103 3300031241 Ga0265325_10021890 Ga0265325_100218902 465
104 3300031247 Ga0265340_10005475 Ga0265340_100054754 465
105 3300031247 Ga0265340_10057593 Ga0265340_100575932 465
106 3300031249 Ga0265339_10016223 Ga0265339_100162234 465
107 3300031250 Ga0265331_10060255 Ga0265331_100602551 465
108 3300031251 Ga0265327_10001054 Ga0265327_100010542 465
109 3300031251 Ga0265327_10008483 Ga0265327_100084834 465
110 3300031251 Ga0265327_10029399 Ga0265327_100293993 465
111 3300031344 Ga0265316_10001020 Ga0265316_1000102011 465
112 3300031344 Ga0265316_10004099 Ga0265316_1000409912 465
113 3300031344 Ga0265316_10039677 Ga0265316_100396774 465
114 3300031344 Ga0265316_10057520 Ga0265316_100575203 465
115 3300031344 Ga0265316_10069627 Ga0265316_100696272 465
116 3300031595 Ga0265313_10014725 Ga0265313_100147253 465
117 3300035084 Ga0373928_0001225 Ga0373928_0001225_1144_2622 465
118 3300035085 Ga0373929_0000988 Ga0373929_0000988_2624_4102 465
119 3300035089 Ga0373944_0000050 Ga0373944_0000050_7120_8520 465
120 3300035090 Ga0373949_0002335 Ga0373949_0002335_2573_4051 465
121 3300035091 Ga0373951_0000454 Ga0373951_0000454_9605_11083 465
122 3300035112 Ga0373932_0000004 Ga0373932_0000004_138828_140306 465
123 3300035114 Ga0373939_0014469 Ga0373939_0014469_627_2027 465
124 3300035118 Ga0373954_0002170 Ga0373954_0002170_1377_2777 465
125 3300035171 Ga0373946_0011530 Ga0373946_0011530_742_2142 465
126 3300035242 Ga0373962_0000044 Ga0373962_0000044_20080_21558 465
127 3300035691 Ga0373931_0000018 Ga0373931_0000018_49976_51454 465
128 3300035695 Ga0373927_0006378 Ga0373927_0006378_90_1490 465
129 3300035695 Ga0373927_0009238 Ga0373927_0009238_450_1850 465
130 3300035724 Ga0373933_0028341 Ga0373933_0028341_1180_2580 465
131 3300035725 Ga0373947_0007031 Ga0373947_0007031_1534_2934 465
132 3300035725 Ga0373947_0039620 Ga0373947_0039620_398_1798 465
133 3300036401 Ga0373937_0005678 Ga0373937_0005678_5209_6609 465
134 3300036401 Ga0373937_0178856 Ga0373937_0178856_182_1603 465
135 3300037068 Ga0373925_0001624 Ga0373925_0001624_7590_8990 465
136 3300037068 Ga0373925_0006037 Ga0373925_0006037_2544_3944 465
137 3300042876 Ga0451577_0020148 Ga0451577_0020148_285_1727 465
138 3300044712 Ga0453684_0005590 Ga0453684_0005590_308_1750 465
139 3300044712 Ga0453684_0184304 Ga0453684_0184304_897_2306 465
140 3300046454 Ga0495592_0081110 Ga0495592_0081110_291_1700 465
141 3300046535 Ga0495586_0000477 Ga0495586_0000477_8721_10121 465
142 3300046642 Ga0495634_0005142 Ga0495634_0005142_4631_6031 465
143 3300046675 Ga0495657_0019573 Ga0495657_0019573_2660_4063 465
144 3300046689 Ga0495613_0001737 Ga0495613_0001737_10190_11590 465
145 3300047319 Ga0495674_0074017 Ga0495674_0074017_820_2241 465
146 3300047322 Ga0495680_0004846 Ga0495680_0004846_1139_2539 465
147 3300048918 Ga0496115_0002172 Ga0496115_0002172_10118_11521 465
148 3300049568 Ga0501031_0000759 Ga0501031_0000759_16770_18170 465
149 3300049569 Ga0501032_0011238 Ga0501032_0011238_3776_5176 465
150 3300049570 Ga0501033_0003433 Ga0501033_0003433_9387_10787 465
151 3300049822 Ga0501035_0004226 Ga0501035_0004226_10967_12367 465
152 3300049822 Ga0501035_0028355 Ga0501035_0028355_3500_4900 465
153 3300049823 Ga0501044_0002708 Ga0501044_0002708_16815_18215 465
154 3300049823 Ga0501044_0040414 Ga0501044_0040414_2057_3457 465
155 3300050511 nmdc:mga08y16_244283_c1 nmdc:mga08y16_244283_c1_430_1833 465

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00206

Lyase_1

Lyase

48

347

0.98

PF14698

ASL_C2

Argininosuccinate lyase C-terminal

410

478

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hy0-assembly1.cif.gz_B crystal structure of wild type duck delta 1 crystallin (eye lens protein) 0.936 19 464
1dcn-assembly1.cif.gz_A inactive mutant h162n of delta 2 crystallin with bound argininosuccinate 0.9347 32 464
1k7w-assembly1.cif.gz_C crystal structure of s283a duck delta 2 crystallin mutant 0.9301 19 464
1dcn-assembly1.cif.gz_C inactive mutant h162n of delta 2 crystallin with bound argininosuccinate 0.9291 19 464
1dcn-assembly1.cif.gz_B inactive mutant h162n of delta 2 crystallin with bound argininosuccinate 0.9279 15 464
ID Description Score Start End Superfamily
af_F1RA91_366_428_1.10.40.30 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9888 371 431 1.10.40.30
af_P04424_365_429_1.10.40.30 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9863 371 434 1.10.40.30
1auwB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9852 371 438 1.10.40.30
af_P40369_372_429_1.10.40.30 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9844 377 432 1.10.40.30
1k62A03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9825 371 438 1.10.40.30
ID Description Score Start End GO Terms
AF-A0A257GWB8-F1-model_v4 Argininosuccinate lyase (EC 4.3.2.1) 0.9455 52 285 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A3M0ZJ71-F1-model_v4 Argininosuccinate lyase (EC 4.3.2.1) 0.9444 104 464 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A3D1ZL30-F1-model_v4 argininosuccinate lyase (EC 4.3.2.1) 0.9421 14 196 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A6I4ZL14-F1-model_v4 Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) 0.9398 20 464 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A7Y4YXJ4-F1-model_v4 Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) 0.9377 22 464 GO:0004056
GO:0005829
GO:0006526
GO:0042450

Feature Viewer

pLDDT pTM Quality
83.14 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map