F222472

General Info

Members Datasets Scaffolds Average Seq Length
155 130 310 130

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10444086|Ga0207665_104440861
Length 120
Sequence MRFMILVKATQDSEAGLMPSEKLMSEPSSKGWRVKYSGAKRTVIDGPFAEAKELIAGYTIIQVKSREEAMEWARRFPNPSIDGKEAEIEVRQFFELEDFGPSEAVERFREMEKDARQREN

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
128 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
129 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
130 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.52
Nodule 0.65
Rhizoplane 0.65
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10444086 3300025939 Bacteria 994
2 JGI25150J39212_1000161 3300002774 Bacteria 37806
3 JGI25151J46595_10046877 3300003187 Bacteria 1509
4 JGI25153J46596_10000346 3300003215 Bacteria 32378
5 rootL2_10085823 3300003322 Bacteria 1072
6 Ga0055536_1017736 3300003781 Bacteria 2316
7 Ga0055536_1055994 3300003781 Bacteria 840
8 Ga0055530_10010018 3300003791 Bacteria 3562
9 Ga0055530_10012633 3300003791 Bacteria 2931
10 Ga0055540_1000735 3300003792 Bacteria 22261
11 Ga0055540_1002426 3300003792 Bacteria 9855
12 Ga0055540_1064438 3300003792 Bacteria 726
13 Ga0055531_10013334 3300003794 Bacteria 3795
14 Ga0055531_10024763 3300003794 Bacteria 2201
15 Ga0070658_10939082 3300005327 Bacteria 752
16 Ga0070661_100132257 3300005344 Bacteria 1875
17 Ga0070671_100686422 3300005355 Bacteria 888
18 Ga0070659_100091887 3300005366 Bacteria 2433
19 Ga0070709_10739414 3300005434 Bacteria 768
20 Ga0070708_101765697 3300005445 Bacteria 574
21 Ga0070662_100132347 3300005457 Bacteria 1924
22 Ga0070699_101283768 3300005518 Bacteria 671
23 Ga0070697_100383509 3300005536 Bacteria 1217
24 Ga0070697_100521470 3300005536 Bacteria 1040
25 Ga0068853_100402737 3300005539 Bacteria 1281
26 Ga0070672_100290109 3300005543 Bacteria 1385
27 Ga0070664_100048963 3300005564 Bacteria 3573
28 Ga0068859_100000946 3300005617 Bacteria 29704
29 Ga0068864_100202515 3300005618 Bacteria 1824
30 Ga0068866_10960577 3300005718 Bacteria 605
31 Ga0068861_100000093 3300005719 Bacteria 43247
32 Ga0068860_100001207 3300005843 Bacteria 28190
33 Ga0081455_10138792 3300005937 Bacteria 1891
34 Ga0070717_10269593 3300006028 Bacteria 1508
35 Ga0075365_10027879 3300006038 Bacteria 3597
36 Ga0075362_10673800 3300006177 Bacteria 538
37 Ga0075366_10442289 3300006195 Bacteria 802
38 Ga0097621_100010565 3300006237 Bacteria 6763
39 Ga0068871_100024249 3300006358 Bacteria 4701
40 Ga0068871_100106478 3300006358 Bacteria 2354
41 Ga0075436_100043593 3300006914 Bacteria 3093
42 Ga0097620_100000946 3300006931 Bacteria 29704
43 Ga0075435_100938762 3300007076 Bacteria 755
44 Ga0105251_10000020 3300009011 Bacteria 138675
45 Ga0105250_10000323 3300009092 Bacteria 36764
46 Ga0105240_10169065 3300009093 Bacteria 2591
47 Ga0105245_10099380 3300009098 Bacteria 2690
48 Ga0105241_10003732 3300009174 Bacteria 11310
49 Ga0105241_10497999 3300009174 Bacteria 1086
50 Ga0105241_10628552 3300009174 Bacteria 973
51 Ga0105248_10003692 3300009177 Bacteria 16963
52 Ga0105237_10223879 3300009545 Bacteria 1881
53 Ga0105238_10373482 3300009551 Bacteria 1416
54 Ga0157373_10680307 3300013100 Bacteria 753
55 Ga0157370_10090082 3300013104 Bacteria 2880
56 Ga0157369_10140201 3300013105 Bacteria 2559
57 Ga0157378_10713043 3300013297 Bacteria 1023
58 Ga0157372_10566803 3300013307 Bacteria 1324
59 Ga0157372_11835362 3300013307 Bacteria 697
60 Ga0157375_13400800 3300013308 Bacteria 530
61 Ga0157379_10000463 3300014968 Bacteria 32854
62 Ga0157379_10101374 3300014968 Bacteria 2584
63 Ga0157376_10471764 3300014969 Bacteria 1228
64 Ga0157376_11789625 3300014969 Bacteria 650
65 Ga0213876_10405390 3300021384 Bacteria 725
66 Ga0207425_1000016 3300025245 Bacteria 428169
67 Ga0209129_1000857 3300025258 Bacteria 19042
68 Ga0209565_1033187 3300025263 Bacteria 995
69 Ga0209676_1010482 3300025292 Bacteria 3853
70 Ga0209676_1013809 3300025292 Bacteria 3080
71 Ga0209025_1000498 3300025294 Bacteria 75517
72 Ga0209758_1000009 3300025297 Bacteria 1123483
73 Ga0209050_1000005 3300025298 Bacteria 1557793
74 Ga0209050_1010380 3300025298 Bacteria 4599
75 Ga0209050_1011045 3300025298 Bacteria 4348
76 Ga0209051_1000432 3300025303 Bacteria 57026
77 Ga0209051_1039361 3300025303 Bacteria 1708
78 Ga0209257_1002154 3300025304 Bacteria 20471
79 Ga0209257_1002489 3300025304 Bacteria 18205
80 Ga0207696_1000308 3300025711 Bacteria 56065
81 Ga0207713_1000020 3300025735 Bacteria 359258
82 Ga0207642_10783321 3300025899 Bacteria 605
83 Ga0207654_10001742 3300025911 Bacteria 11308
84 Ga0207695_10628811 3300025913 Bacteria 955
85 Ga0207649_10701774 3300025920 Bacteria 785
86 Ga0207694_10267858 3300025924 Bacteria 1401
87 Ga0207687_10090107 3300025927 Bacteria 2234
88 Ga0207687_10571500 3300025927 Bacteria 950
89 Ga0207690_10065929 3300025932 Bacteria 2478
90 Ga0207706_10091655 3300025933 Bacteria 2672
91 Ga0207691_10174001 3300025940 Bacteria 1884
92 Ga0207711_10010717 3300025941 Bacteria 7624
93 Ga0207679_10435303 3300025945 Bacteria 1160
94 Ga0207667_11058216 3300025949 Bacteria 796
95 Ga0207639_12226386 3300026041 Bacteria 509
96 Ga0207675_100000011 3300026118 Bacteria 143162
97 Ga0268265_12711483 3300028380 Bacteria 501
98 Ga0268264_10000149 3300028381 Bacteria 163972
99 Ga0307513_10400650 3300031456 Bacteria 1107
100 Ga0307405_10000735 3300031731 Bacteria 12745
101 Ga0307405_10009454 3300031731 Bacteria 5000
102 Ga0307413_10084458 3300031824 Bacteria 2046
103 Ga0307413_10676206 3300031824 Bacteria 855
104 Ga0307412_10013043 3300031911 Bacteria 4859
105 Ga0307412_10090668 3300031911 Bacteria 2137
106 Ga0307412_10241476 3300031911 Bacteria 1397
107 Ga0307409_100073239 3300031995 Bacteria 2731
108 Ga0307416_100876466 3300032002 Bacteria 997
109 Ga0307414_10015270 3300032004 Bacteria 4633
110 Ga0307411_10064815 3300032005 Bacteria 2447
111 Ga0307510_10069543 3300033180 Bacteria 3525
112 Ga0395900_0391884 3300037418 Bacteria 1355
113 Ga0395905_0055192 3300037471 Bacteria 3718
114 Ga0395905_0760432 3300037471 Bacteria 871
115 Ga0395901_0169285 3300038443 Bacteria 2292
116 Ga0436365_0627785 3300039437 Bacteria 4649
117 Ga0451853_0027876 3300041512 Bacteria 1599
118 Ga0439445_0097011 3300042004 Bacteria 834
119 Ga0439462_0000097 3300042015 Bacteria 13616
120 Ga0495638_0000484 3300046460 Bacteria 47792
121 Ga0495638_0612141 3300046460 Bacteria 533
122 Ga0495632_0154433 3300046519 Bacteria 1060
123 Ga0495643_0226778 3300046522 Bacteria 883
124 Ga0495654_0164215 3300046530 Bacteria 973
125 Ga0495587_0531193 3300046536 Bacteria 649
126 Ga0495672_0188925 3300047320 Bacteria 1037
127 Ga0495687_042058 3300047443 Bacteria 2000
128 Ga0495686_0404673 3300047472 Unclassified 732
129 Ga0496102_0256599 3300048905 Bacteria 1648
130 Ga0496118_0210330 3300048921 Bacteria 1142
131 Ga0496126_0780708 3300048929 Bacteria 735
132 Ga0501031_0448813 3300049568 Bacteria 833
133 Ga0501032_0338531 3300049569 Bacteria 970
134 Ga0501037_0289013 3300049573 Bacteria 1141
135 Ga0501038_0551720 3300049574 Bacteria 876
136 Ga0501048_0717685 3300049582 Bacteria 718
137 Ga0501073_0193449 3300049589 Bacteria 1407
138 Ga0501074_0647454 3300049590 Bacteria 747
139 Ga0501080_1641059 3300049742 Bacteria 544
140 Ga0501083_0011778 3300049744 Bacteria 6130
141 Ga0501044_0937463 3300049823 Bacteria 739
142 nmdc:mga0yw44_232045_c1 3300050492 Bacteria 1225
143 nmdc:mga0k408_284831_c1 3300050493 Bacteria 986
144 nmdc:mga07m45_309645_c1 3300050496 Bacteria 918
145 Ga0500583_0270970 3300053092 Bacteria 835
146 Ga0500593_001160 3300053117 Bacteria 9508
147 Ga0500652_002017 3300053131 Bacteria 6117
148 Ga0500568_0001527 3300053139 Bacteria 14735
149 Ga0500616_0001791 3300053153 Bacteria 19569
150 Ga0500616_0002800 3300053153 Bacteria 14047
151 Ga0501082_1924968 3300060353 Bacteria 515
152 2643756277 2643221547 Bacteria 4740017
153 2839994358 2839993093 Bacteria 5512535
154 2894655268 2894652903 Bacteria 4587256
155 8024491756 8024486573 Bacteria 6540512
156 Ga0207665_10444086
157 JGI25150J39212_1000161
158 JGI25151J46595_10046877
159 JGI25153J46596_10000346
160 rootL2_10085823
161 Ga0055536_1017736
162 Ga0055536_1055994
163 Ga0055530_10010018
164 Ga0055530_10012633
165 Ga0055540_1000735
166 Ga0055540_1002426
167 Ga0055540_1064438
168 Ga0055531_10013334
169 Ga0055531_10024763
170 Ga0070658_10939082
171 Ga0070661_100132257
172 Ga0070671_100686422
173 Ga0070659_100091887
174 Ga0070709_10739414
175 Ga0070708_101765697
176 Ga0070662_100132347
177 Ga0070699_101283768
178 Ga0070697_100383509
179 Ga0070697_100521470
180 Ga0068853_100402737
181 Ga0070672_100290109
182 Ga0070664_100048963
183 Ga0068859_100000946
184 Ga0068864_100202515
185 Ga0068866_10960577
186 Ga0068861_100000093
187 Ga0068860_100001207
188 Ga0081455_10138792
189 Ga0070717_10269593
190 Ga0075365_10027879
191 Ga0075362_10673800
192 Ga0075366_10442289
193 Ga0097621_100010565
194 Ga0068871_100024249
195 Ga0068871_100106478
196 Ga0075436_100043593
197 Ga0097620_100000946
198 Ga0075435_100938762
199 Ga0105251_10000020
200 Ga0105250_10000323
201 Ga0105240_10169065
202 Ga0105245_10099380
203 Ga0105241_10003732
204 Ga0105241_10497999
205 Ga0105241_10628552
206 Ga0105248_10003692
207 Ga0105237_10223879
208 Ga0105238_10373482
209 Ga0157373_10680307
210 Ga0157370_10090082
211 Ga0157369_10140201
212 Ga0157378_10713043
213 Ga0157372_10566803
214 Ga0157372_11835362
215 Ga0157375_13400800
216 Ga0157379_10000463
217 Ga0157379_10101374
218 Ga0157376_10471764
219 Ga0157376_11789625
220 Ga0213876_10405390
221 Ga0207425_1000016
222 Ga0209129_1000857
223 Ga0209565_1033187
224 Ga0209676_1010482
225 Ga0209676_1013809
226 Ga0209025_1000498
227 Ga0209758_1000009
228 Ga0209050_1000005
229 Ga0209050_1010380
230 Ga0209050_1011045
231 Ga0209051_1000432
232 Ga0209051_1039361
233 Ga0209257_1002154
234 Ga0209257_1002489
235 Ga0207696_1000308
236 Ga0207713_1000020
237 Ga0207642_10783321
238 Ga0207654_10001742
239 Ga0207695_10628811
240 Ga0207649_10701774
241 Ga0207694_10267858
242 Ga0207687_10090107
243 Ga0207687_10571500
244 Ga0207690_10065929
245 Ga0207706_10091655
246 Ga0207691_10174001
247 Ga0207711_10010717
248 Ga0207679_10435303
249 Ga0207667_11058216
250 Ga0207639_12226386
251 Ga0207675_100000011
252 Ga0268265_12711483
253 Ga0268264_10000149
254 Ga0307513_10400650
255 Ga0307405_10000735
256 Ga0307405_10009454
257 Ga0307413_10084458
258 Ga0307413_10676206
259 Ga0307412_10013043
260 Ga0307412_10090668
261 Ga0307412_10241476
262 Ga0307409_100073239
263 Ga0307416_100876466
264 Ga0307414_10015270
265 Ga0307411_10064815
266 Ga0307510_10069543
267 Ga0395900_0391884
268 Ga0395905_0055192
269 Ga0395905_0760432
270 Ga0395901_0169285
271 Ga0436365_0627785
272 Ga0451853_0027876
273 Ga0439445_0097011
274 Ga0439462_0000097
275 Ga0495638_0000484
276 Ga0495638_0612141
277 Ga0495632_0154433
278 Ga0495643_0226778
279 Ga0495654_0164215
280 Ga0495587_0531193
281 Ga0495672_0188925
282 Ga0495687_042058
283 Ga0495686_0404673
284 Ga0496102_0256599
285 Ga0496118_0210330
286 Ga0496126_0780708
287 Ga0501031_0448813
288 Ga0501032_0338531
289 Ga0501037_0289013
290 Ga0501038_0551720
291 Ga0501048_0717685
292 Ga0501073_0193449
293 Ga0501074_0647454
294 Ga0501080_1641059
295 Ga0501083_0011778
296 Ga0501044_0937463
297 nmdc:mga0yw44_232045_c1
298 nmdc:mga0k408_284831_c1
299 nmdc:mga07m45_309645_c1
300 Ga0500583_0270970
301 Ga0500593_001160
302 Ga0500652_002017
303 Ga0500568_0001527
304 Ga0500616_0001791
305 Ga0500616_0002800
306 Ga0501082_1924968
307 2643756277
308 2839994358
309 2894655268
310 8024491756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

94

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7489 2 114
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7259 1 114
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7192 1 114
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6943 1 114
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6909 1 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7489 2 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6868 2 114 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6813 1 115 3.30.70.1060
af_P0ACJ5_55_139_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6799 2 110 3.30.70.920
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6799 1 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A6J4KQU2-F1-model_v4 PhnB protein 0.952 1 104
AF-A0A522BNQ7-F1-model_v4 YciI family protein 0.9466 1 98
AF-A0A534STC8-F1-model_v4 Bacterial transcription activator effector binding domain-containing protein 0.9414 1 137
AF-A0A178U656-F1-model_v4 Uncharacterized protein 0.941 1 110 GO:0003677
GO:0003824
GO:0006352
GO:0016987
AF-A0A7G9NYV5-F1-model_v4 YciI family protein 0.9387 1 139

Map