F222447

General Info

Members Datasets Scaffolds Average Seq Length
155 110 310 373

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10008899|Ga0207664_100088993
Length 392
Sequence MNWRRAAGSLRRPEEVMKISGSILIALLYVIMTARSQTTLKEAYGKDFLVGAALNEAVFSGQNPDEAALVAQQFNTISPENVLKWETVHPDPGVFDFTAADKYVDFGVKNKMFVVGHNLIWHSQTPKWVFEDAAGKPVSRDTLLARMREHIFTVVGRYKGRIGGWDVVNEALAEDGSLRQSPWRRIIGEDYLLKAYQFAHEADPHAELYYNDYALENLPKRAGAIALIRKLQSQGVHIAAIGLQGHYRLDSPAASEVGETISAMSKLGLKVMITELDVDVLPHVDHFGEADVSLSYSPRPEWNPYTNGLPDSIQQQLSERYADLFAVFLQHREVISRVTFWGVTDSDSWLNGWPVRGRTSYPLLFDRAGKPKPAFLAVVAAAQKTAAMKIDP

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 19.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10008899 3300025929 Bacteria 7031
2 rootL2_10133496 3300003322 Bacteria 3790
3 rootH1_10156140 3300003323 Bacteria 2445
4 rootH1_10298571 3300003323 Bacteria 2909
5 Ga0065712_10000489 3300005290 Bacteria 11903
6 Ga0065712_10101668 3300005290 Unclassified 2028
7 Ga0065715_10090866 3300005293 Bacteria 6367
8 Ga0070670_100152703 3300005331 Unclassified 1999
9 Ga0070666_10042996 3300005335 Unclassified 3024
10 Ga0070680_100000843 3300005336 Bacteria 21700
11 Ga0070680_100038717 3300005336 Bacteria 3857
12 Ga0070682_100000807 3300005337 Bacteria 18391
13 Ga0070682_100009872 3300005337 Bacteria 5406
14 Ga0068868_100090255 3300005338 Bacteria 2467
15 Ga0070660_100000878 3300005339 Bacteria 20082
16 Ga0070689_100068801 3300005340 Bacteria 2762
17 Ga0070661_100195363 3300005344 Bacteria 1544
18 Ga0070714_100064548 3300005435 Bacteria 3152
19 Ga0070681_10026738 3300005458 Bacteria 5801
20 Ga0070679_100000868 3300005530 Bacteria 26282
21 Ga0070679_100012777 3300005530 Bacteria 8034
22 Ga0070679_100056505 3300005530 Bacteria 3911
23 Ga0068855_100059679 3300005563 Bacteria 4463
24 Ga0068855_100248551 3300005563 Bacteria 1984
25 Ga0068855_100336157 3300005563 Unclassified 1666
26 Ga0068857_100104348 3300005577 Bacteria 2545
27 Ga0068856_100000343 3300005614 Bacteria 50941
28 Ga0068852_100006878 3300005616 Bacteria 8266
29 Ga0068852_100062164 3300005616 Bacteria 3247
30 Ga0068852_100141431 3300005616 Bacteria 2227
31 Ga0068859_100143275 3300005617 Unclassified 2463
32 Ga0068864_100035951 3300005618 Unclassified 4219
33 Ga0068864_100240514 3300005618 Bacteria 1677
34 Ga0068851_10022181 3300005834 Bacteria 3090
35 Ga0068870_10080732 3300005840 Unclassified 1797
36 Ga0068863_100010429 3300005841 Bacteria 9031
37 Ga0068858_100123652 3300005842 Bacteria 2421
38 Ga0068860_100000026 3300005843 Bacteria 270483
39 Ga0068860_100046220 3300005843 Bacteria 4151
40 Ga0068860_100046250 3300005843 Unclassified 4149
41 Ga0081539_10008827 3300005985 Bacteria 8626
42 Ga0075430_100071499 3300006846 Bacteria 2910
43 Ga0075433_10004863 3300006852 Bacteria 10509
44 Ga0097620_100143280 3300006931 Unclassified 2463
45 Ga0105240_10057443 3300009093 Bacteria 4862
46 Ga0111539_10163758 3300009094 Bacteria 2601
47 Ga0111539_10402791 3300009094 Bacteria 1593
48 Ga0105241_10000901 3300009174 Bacteria 22446
49 Ga0105241_10048920 3300009174 Bacteria 3219
50 Ga0105242_10067339 3300009176 Unclassified 2960
51 Ga0105248_10019592 3300009177 Bacteria 7488
52 Ga0105239_10023747 3300010375 Bacteria 6752
53 Ga0157373_10017383 3300013100 Bacteria 5239
54 Ga0157373_10064574 3300013100 Unclassified 2591
55 Ga0157371_10020443 3300013102 Bacteria 4872
56 Ga0157371_10149170 3300013102 Bacteria 1667
57 Ga0157370_10002426 3300013104 Bacteria 22474
58 Ga0157370_10007827 3300013104 Bacteria 11580
59 Ga0157369_10435839 3300013105 Unclassified 1358
60 Ga0157374_10004445 3300013296 Bacteria 11785
61 Ga0157374_10161923 3300013296 Bacteria 2179
62 Ga0157378_10054215 3300013297 Unclassified 3570
63 Ga0163162_10001816 3300013306 Bacteria 20061
64 Ga0157372_10048183 3300013307 Bacteria 4737
65 Ga0157375_10018795 3300013308 Bacteria 6272
66 Ga0163163_10000372 3300014325 Bacteria 43034
67 Ga0163163_10082138 3300014325 Unclassified 3226
68 Ga0157380_10048083 3300014326 Unclassified 3358
69 Ga0157376_10035944 3300014969 Unclassified 4010
70 Ga0207643_10082734 3300025908 Unclassified 1861
71 Ga0207705_10135378 3300025909 Unclassified 1836
72 Ga0207654_10000591 3300025911 Bacteria 20442
73 Ga0207654_10013777 3300025911 Bacteria 4165
74 Ga0207707_10000192 3300025912 Bacteria 64424
75 Ga0207707_10022401 3300025912 Bacteria 5522
76 Ga0207695_10194948 3300025913 Bacteria 1942
77 Ga0207671_10052764 3300025914 Bacteria 3013
78 Ga0207660_10000844 3300025917 Bacteria 20184
79 Ga0207657_10005988 3300025919 Bacteria 12657
80 Ga0207657_10071841 3300025919 Bacteria 2929
81 Ga0207652_10001184 3300025921 Bacteria 23471
82 Ga0207652_10001700 3300025921 Bacteria 19266
83 Ga0207652_10222271 3300025921 Bacteria 1702
84 Ga0207659_10028695 3300025926 Bacteria 3784
85 Ga0207700_10188065 3300025928 Bacteria 1734
86 Ga0207670_10074478 3300025936 Unclassified 2357
87 Ga0207670_10103456 3300025936 Bacteria 2038
88 Ga0207669_10189599 3300025937 Bacteria 1482
89 Ga0207691_10033009 3300025940 Bacteria 4822
90 Ga0207691_10096233 3300025940 Bacteria 2647
91 Ga0207711_10006924 3300025941 Bacteria 9518
92 Ga0207667_10038674 3300025949 Bacteria 5092
93 Ga0207667_10088558 3300025949 Bacteria 3201
94 Ga0207703_10094873 3300026035 Bacteria 2516
95 Ga0207639_10003218 3300026041 Bacteria 10983
96 Ga0207639_10332319 3300026041 Bacteria 1353
97 Ga0207641_10000854 3300026088 Bacteria 32297
98 Ga0207676_10031135 3300026095 Unclassified 4010
99 Ga0207676_10271745 3300026095 Bacteria 1535
100 Ga0207674_10022695 3300026116 Bacteria 6737
101 Ga0207674_10028361 3300026116 Bacteria 5910
102 Ga0207698_10032634 3300026142 Bacteria 3775
103 Ga0268265_10259876 3300028380 Unclassified 1543
104 Ga0268264_10000455 3300028381 Bacteria 55791
105 Ga0265337_1000108 3300028556 Bacteria 41858
106 Ga0265319_1005368 3300028563 Bacteria 6146
107 Ga0265318_10007158 3300028577 Bacteria 5072
108 Ga0265323_10000031 3300028653 Bacteria 77683
109 Ga0265336_10000385 3300028666 Bacteria 28195
110 Ga0265338_10000331 3300028800 Bacteria 85997
111 Ga0265338_10000580 3300028800 Bacteria 64333
112 Ga0265338_10001320 3300028800 Bacteria 40589
113 Ga0265338_10005530 3300028800 Bacteria 16463
114 Ga0265338_10018896 3300028800 Bacteria 7346
115 Ga0265338_10183613 3300028800 Unclassified 1592
116 Ga0265320_10002165 3300031240 Bacteria 13789
117 Ga0265320_10002815 3300031240 Bacteria 11967
118 Ga0265320_10015800 3300031240 Bacteria 4254
119 Ga0265320_10023391 3300031240 Bacteria 3290
120 Ga0265339_10021660 3300031249 Unclassified 3734
121 Ga0265316_10103024 3300031344 Unclassified 2167
122 Ga0265313_10000337 3300031595 Bacteria 50974
123 Ga0307407_10070428 3300031903 Unclassified 2079
124 Ga0307409_100104312 3300031995 Bacteria 2361
125 Ga0307416_100049254 3300032002 Bacteria 3349
126 Ga0373956_0078965 3300035119 Unclassified 1508
127 Ga0373924_0021125 3300035410 Unclassified 2538
128 Ga0373937_0011705 3300036401 Bacteria 7694
129 Ga0373937_0160742 3300036401 Bacteria 2106
130 Ga0373937_0195128 3300036401 Bacteria 1903
131 Ga0395899_0000785 3300037312 Bacteria 31067
132 Ga0395900_0001955 3300037418 Bacteria 23285
133 Ga0395900_0066960 3300037418 Bacteria 3690
134 Ga0395898_0003741 3300037466 Bacteria 16867
135 Ga0395901_0003402 3300038443 Bacteria 16024
136 Ga0395901_0432324 3300038443 Bacteria 1348
137 Ga0436365_1432011 3300039437 Bacteria 3312
138 Ga0453684_0004612 3300044712 Bacteria 28696
139 Ga0453684_0133890 3300044712 Bacteria 2970
140 Ga0451576_0000109 3300045051 Bacteria 210549
141 Ga0451576_0002619 3300045051 Bacteria 26328
142 Ga0495653_0088946 3300046463 Unclassified 2264
143 Ga0495608_0044740 3300046511 Unclassified 2954
144 Ga0495628_0042274 3300046516 Bacteria 3635
145 Ga0495630_0001329 3300046517 Bacteria 16997
146 Ga0495667_0128144 3300046559 Bacteria 1637
147 Ga0495600_0150699 3300046809 Bacteria 1506
148 Ga0495674_0127685 3300047319 Bacteria 2144
149 Ga0501033_0047627 3300049570 Bacteria 3187
150 Ga0501034_0261108 3300049571 Bacteria 1675
151 Ga0501073_0121408 3300049589 Bacteria 1811
152 nmdc:mga06r32_24233_c1 3300050510 Bacteria 5628
153 nmdc:mga0n895_2542_c1 3300050512 Bacteria 14288
154 nmdc:mga0a205_2027_c1 3300050515 Bacteria 17695
155 Ga0500568_0016286 3300053139 Unclassified 3310
156 Ga0207664_10008899
157 rootL2_10133496
158 rootH1_10156140
159 rootH1_10298571
160 Ga0065712_10000489
161 Ga0065712_10101668
162 Ga0065715_10090866
163 Ga0070670_100152703
164 Ga0070666_10042996
165 Ga0070680_100000843
166 Ga0070680_100038717
167 Ga0070682_100000807
168 Ga0070682_100009872
169 Ga0068868_100090255
170 Ga0070660_100000878
171 Ga0070689_100068801
172 Ga0070661_100195363
173 Ga0070714_100064548
174 Ga0070681_10026738
175 Ga0070679_100000868
176 Ga0070679_100012777
177 Ga0070679_100056505
178 Ga0068855_100059679
179 Ga0068855_100248551
180 Ga0068855_100336157
181 Ga0068857_100104348
182 Ga0068856_100000343
183 Ga0068852_100006878
184 Ga0068852_100062164
185 Ga0068852_100141431
186 Ga0068859_100143275
187 Ga0068864_100035951
188 Ga0068864_100240514
189 Ga0068851_10022181
190 Ga0068870_10080732
191 Ga0068863_100010429
192 Ga0068858_100123652
193 Ga0068860_100000026
194 Ga0068860_100046220
195 Ga0068860_100046250
196 Ga0081539_10008827
197 Ga0075430_100071499
198 Ga0075433_10004863
199 Ga0097620_100143280
200 Ga0105240_10057443
201 Ga0111539_10163758
202 Ga0111539_10402791
203 Ga0105241_10000901
204 Ga0105241_10048920
205 Ga0105242_10067339
206 Ga0105248_10019592
207 Ga0105239_10023747
208 Ga0157373_10017383
209 Ga0157373_10064574
210 Ga0157371_10020443
211 Ga0157371_10149170
212 Ga0157370_10002426
213 Ga0157370_10007827
214 Ga0157369_10435839
215 Ga0157374_10004445
216 Ga0157374_10161923
217 Ga0157378_10054215
218 Ga0163162_10001816
219 Ga0157372_10048183
220 Ga0157375_10018795
221 Ga0163163_10000372
222 Ga0163163_10082138
223 Ga0157380_10048083
224 Ga0157376_10035944
225 Ga0207643_10082734
226 Ga0207705_10135378
227 Ga0207654_10000591
228 Ga0207654_10013777
229 Ga0207707_10000192
230 Ga0207707_10022401
231 Ga0207695_10194948
232 Ga0207671_10052764
233 Ga0207660_10000844
234 Ga0207657_10005988
235 Ga0207657_10071841
236 Ga0207652_10001184
237 Ga0207652_10001700
238 Ga0207652_10222271
239 Ga0207659_10028695
240 Ga0207700_10188065
241 Ga0207670_10074478
242 Ga0207670_10103456
243 Ga0207669_10189599
244 Ga0207691_10033009
245 Ga0207691_10096233
246 Ga0207711_10006924
247 Ga0207667_10038674
248 Ga0207667_10088558
249 Ga0207703_10094873
250 Ga0207639_10003218
251 Ga0207639_10332319
252 Ga0207641_10000854
253 Ga0207676_10031135
254 Ga0207676_10271745
255 Ga0207674_10022695
256 Ga0207674_10028361
257 Ga0207698_10032634
258 Ga0268265_10259876
259 Ga0268264_10000455
260 Ga0265337_1000108
261 Ga0265319_1005368
262 Ga0265318_10007158
263 Ga0265323_10000031
264 Ga0265336_10000385
265 Ga0265338_10000331
266 Ga0265338_10000580
267 Ga0265338_10001320
268 Ga0265338_10005530
269 Ga0265338_10018896
270 Ga0265338_10183613
271 Ga0265320_10002165
272 Ga0265320_10002815
273 Ga0265320_10015800
274 Ga0265320_10023391
275 Ga0265339_10021660
276 Ga0265316_10103024
277 Ga0265313_10000337
278 Ga0307407_10070428
279 Ga0307409_100104312
280 Ga0307416_100049254
281 Ga0373956_0078965
282 Ga0373924_0021125
283 Ga0373937_0011705
284 Ga0373937_0160742
285 Ga0373937_0195128
286 Ga0395899_0000785
287 Ga0395900_0001955
288 Ga0395900_0066960
289 Ga0395898_0003741
290 Ga0395901_0003402
291 Ga0395901_0432324
292 Ga0436365_1432011
293 Ga0453684_0004612
294 Ga0453684_0133890
295 Ga0451576_0000109
296 Ga0451576_0002619
297 Ga0495653_0088946
298 Ga0495608_0044740
299 Ga0495628_0042274
300 Ga0495630_0001329
301 Ga0495667_0128144
302 Ga0495600_0150699
303 Ga0495674_0127685
304 Ga0501033_0047627
305 Ga0501034_0261108
306 Ga0501073_0121408
307 nmdc:mga06r32_24233_c1
308 nmdc:mga0n895_2542_c1
309 nmdc:mga0a205_2027_c1
310 Ga0500568_0016286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00331

Glyco_hydro_10

Glycosyl hydrolase family 10

39

381

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pmu-assembly2.cif.gz_C crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (xyna) belonging to gh10 family (space group p1211) 0.955 31 372
4k68-assembly2.cif.gz_B structure of a novel gh10 endoxylanase retrieved from sugarcane soil metagenome 0.9522 31 367
1ur1-assembly1.cif.gz_A xylanase xyn10b mutant (e262s) from cellvibrio mixtus in complex with arabinofuranose alpha-1,3 linked to xylobiose 0.9464 31 372
1uqy-assembly1.cif.gz_A xylanase xyn10b mutant (e262s) from cellvibrio mixtus in complex with xylopentaose 0.9446 31 372
2cnc-assembly1.cif.gz_A family 10 xylanase 0.9436 31 372
ID Description Score Start End Superfamily
4pmuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9514 31 372 3.20.20.80
4k68A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9423 31 369 3.20.20.80
4k68A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9314 31 369 3.20.20.80
1ta3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9287 31 369 3.20.20.80
1vbrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9255 31 371 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A537JFT7-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9934 43 371 GO:0031176
GO:0045493
AF-A0A3B7N9W9-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9916 22 371 GO:0031176
GO:0045493
AF-A0A520IDB4-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9863 142 372 GO:0031176
GO:0045493
AF-B8YER0-F1-model_v4 Family 10 xylanase 0.9831 150 231 GO:0004553
GO:0045493
AF-A0A841EMQ7-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9827 25 372 GO:0004553
GO:0045493

Map