F222325

General Info

Members Datasets Scaffolds Average Seq Length
155 118 306 246

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10032895|Ga0182008_100328952
Length 273
Sequence MKPNDKRTFGFKMGYINYISNKIKNMKRLKNKVAIITGASQGMGESHARMFAKEGAKVIMTDINEDQGIKLASTLGENVIFIRHDVTQVEDWKRVIAEGESKFGPINVLVNNAGILGPIINTADLSEEDYLKVCATNQHSIYYGMKYTIPSMLKAGGGSIVNISSISGIIAVHGFPSLAYMASKFAIRGMTKAAAVEYGINNIRVNTVHPGYIKTPMRAIIVVEGGEDAIKMIPLGRLADPKEVSFLVTFLASDESSYITGTEQIIDGGMSIQ

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
53 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
54 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
55 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
56 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
57 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
62 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
66 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
69 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
70 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
71 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
72 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
73 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
95 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
97 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
98 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
99 2619618881 Frankia sp. ACN1ag Isolate Unclassified
100 2619619003 Frankia sp. CpI1-P Isolate Nodule
101 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
102 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
103 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
104 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
105 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
106 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
107 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
108 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
109 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
110 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
111 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
112 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
113 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
114 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
115 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
116 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
117 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
118 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.29
Metatranscriptomes 0
Isolates 18.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.74
Nodule 1.29
Rhizoplane 12.9
Rhizosphere 58.06
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10032895 3300014497 Bacteria 2603
2 JGI24746J21847_1002392 3300001977 Bacteria 2996
3 rootH1_10090708 3300003316 Bacteria 3267
4 Ga0055538_1000708 3300003751 Bacteria 10129
5 Ga0070666_10399283 3300005335 Bacteria 988
6 Ga0070671_100136597 3300005355 Bacteria 2067
7 Ga0070681_10293699 3300005458 Bacteria 1535
8 Ga0070665_100007349 3300005548 Bacteria 11205
9 Ga0068855_100522918 3300005563 Bacteria 1287
10 Ga0068856_100157298 3300005614 Bacteria 2283
11 Ga0068859_100069740 3300005617 Bacteria 3550
12 Ga0068861_100062974 3300005719 Bacteria 2850
13 Ga0068861_100365310 3300005719 Unclassified 1270
14 Ga0068863_100015612 3300005841 Bacteria 7296
15 Ga0068863_100032554 3300005841 Bacteria 4969
16 Ga0068862_100065977 3300005844 Bacteria 3118
17 Ga0075365_10069787 3300006038 Bacteria 2362
18 Ga0075368_10034768 3300006042 Bacteria 1965
19 Ga0075364_10081454 3300006051 Bacteria 2140
20 Ga0075364_10165656 3300006051 Bacteria 1493
21 Ga0075367_10215349 3300006178 Bacteria 1201
22 Ga0097620_100069747 3300006931 Bacteria 3550
23 Ga0105240_10046278 3300009093 Bacteria 5514
24 Ga0105240_10241196 3300009093 Bacteria 2095
25 Ga0105240_10823099 3300009093 Bacteria 1004
26 Ga0114129_11064635 3300009147 Bacteria 1014
27 Ga0105248_10783499 3300009177 Bacteria 1076
28 Ga0105237_10013023 3300009545 Bacteria 8733
29 Ga0105249_10035116 3300009553 Plasmid 4545
30 Ga0157370_10080988 3300013104 Bacteria 3056
31 Ga0157370_10356795 3300013104 Bacteria 1347
32 Ga0163162_10256408 3300013306 Bacteria 1881
33 Ga0163163_10251143 3300014325 Bacteria 1819
34 Ga0182008_10002918 3300014497 Bacteria 10572
35 Ga0182008_10033353 3300014497 Bacteria 2583
36 Ga0182008_10129123 3300014497 Bacteria 1259
37 Ga0157379_10014080 3300014968 Bacteria 7011
38 Ga0157379_10083264 3300014968 Bacteria 2867
39 Ga0157376_10138596 3300014969 Bacteria 2180
40 Ga0182007_10008010 3300015262 Bacteria 4374
41 Ga0182007_10016045 3300015262 Bacteria 2774
42 Ga0182007_10023621 3300015262 Unclassified 2160
43 Ga0182007_10027696 3300015262 Bacteria 1951
44 Ga0213872_10003782 3300021361 Bacteria 8252
45 Ga0213872_10005063 3300021361 Bacteria 6836
46 Ga0213876_10008049 3300021384 Bacteria 5714
47 Ga0213876_10040435 3300021384 Bacteria 2463
48 Ga0213876_10258071 3300021384 Bacteria 926
49 Ga0209784_100645 3300025224 Bacteria 10459
50 Ga0207697_10145158 3300025315 Bacteria 1031
51 Ga0207644_10112980 3300025931 Bacteria 2056
52 Ga0207667_10275730 3300025949 Bacteria 1719
53 Ga0207668_10031720 3300025972 Bacteria 3484
54 Ga0207658_10210096 3300025986 Bacteria 1630
55 Ga0207703_10284548 3300026035 Bacteria 1503
56 Ga0207702_10167450 3300026078 Bacteria 2012
57 Ga0207641_10653007 3300026088 Bacteria 1033
58 Ga0207675_100012247 3300026118 Bacteria 8010
59 Ga0207675_100056361 3300026118 Bacteria 3665
60 Ga0268266_10007821 3300028379 Bacteria 9582
61 Ga0268264_10053388 3300028381 Bacteria 3371
62 Ga0307509_10000016 3300031507 Bacteria 266991
63 Ga0316576_10127899 3300031727 Bacteria 1910
64 Ga0307516_10000142 3300031730 Bacteria 87194
65 Ga0307410_10196031 3300031852 Bacteria 1539
66 Ga0307510_10260438 3300033180 Bacteria 1216
67 Ga0395901_0890142 3300038443 Bacteria 873
68 Ga0436365_0142660 3300039437 Bacteria 17361
69 Ga0436365_0200691 3300039437 Bacteria 13407
70 Ga0436365_0641432 3300039437 Bacteria 31945
71 Ga0436365_1217634 3300039437 Bacteria 3268
72 Ga0436361_0103354 3300039447 Bacteria 26052
73 Ga0436361_0288677 3300039447 Bacteria 5045
74 Ga0439465_0003986 3300041413 Bacteria 4813
75 Ga0439442_014945 3300042002 Bacteria 1599
76 Ga0439445_0009700 3300042004 Bacteria 2271
77 Ga0439434_0009487 3300042435 Bacteria 2862
78 Ga0439435_0015109 3300042436 Bacteria 1917
79 Ga0466972_0031362 3300044658 Bacteria 2615
80 Ga0466973_0305347 3300044659 Bacteria 1063
81 Ga0466971_0136956 3300044719 Bacteria 1139
82 Ga0495627_000909 3300046453 Bacteria 20494
83 Ga0495650_0001795 3300046471 Bacteria 19375
84 Ga0495582_0013463 3300046473 Bacteria 4503
85 Ga0495632_0009187 3300046519 Bacteria 5975
86 Ga0495665_0066471 3300046531 Bacteria 1903
87 Ga0495633_0082381 3300046558 Bacteria 1497
88 Ga0495633_0093119 3300046558 Bacteria 1400
89 Ga0495625_0001276 3300046660 Bacteria 31632
90 Ga0495671_0008435 3300046692 Bacteria 5800
91 Ga0495581_0139885 3300047315 Bacteria 1412
92 Ga0495681_0001248 3300047470 Bacteria 19301
93 Ga0495686_0001043 3300047472 Bacteria 33269
94 Ga0496100_0021633 3300048903 Bacteria 3878
95 Ga0496100_0630960 3300048903 Bacteria 833
96 Ga0496101_0073696 3300048904 Bacteria 2508
97 Ga0496101_0266676 3300048904 Bacteria 1336
98 Ga0496102_0617351 3300048905 Bacteria 1007
99 Ga0496103_0054529 3300048906 Bacteria 2478
100 Ga0496104_0016978 3300048907 Bacteria 6622
101 Ga0496104_0129142 3300048907 Bacteria 2427
102 Ga0496106_0123691 3300048909 Bacteria 2024
103 Ga0496106_0244853 3300048909 Unclassified 1433
104 Ga0496107_0043552 3300048910 Bacteria 3225
105 Ga0496108_0014313 3300048911 Bacteria 6474
106 Ga0496108_0737053 3300048911 Bacteria 853
107 Ga0496109_0011056 3300048912 Bacteria 7738
108 Ga0496110_0067518 3300048913 Bacteria 3164
109 Ga0496110_0107055 3300048913 Bacteria 2509
110 Ga0496111_0076783 3300048914 Bacteria 2435
111 Ga0496112_0387742 3300048915 Bacteria 1337
112 Ga0496113_0075510 3300048916 Bacteria 2572
113 Ga0496115_0301224 3300048918 Bacteria 1314
114 Ga0496118_0234560 3300048921 Bacteria 1055
115 Ga0496126_0235217 3300048929 Bacteria 1533
116 Ga0495678_072511 3300049459 Unclassified 1258
117 Ga0501035_0611839 3300049822 Bacteria 887
118 Ga0501044_0072119 3300049823 Bacteria 3512
119 nmdc:mga03n38_241505_c1 3300050490 Bacteria 950
120 nmdc:mga00v17_66922_c1 3300050491 Bacteria 2219
121 nmdc:mga0yw44_110568_c1 3300050492 Bacteria 1760
122 nmdc:mga07m45_20378_c1 3300050496 Bacteria 3601
123 Ga0500635_0005017 3300053080 Bacteria 3447
124 Ga0466962_0034218 3300061719 Bacteria 2432
125 2579855609 2579778521 Bacteria 7624758
126 2588234181 2585428187 Bacteria 4629388
127 2619855337 2619618881 Bacteria 7521104
128 2620351729 2619619003 Bacteria 7619552
129 2644502970 2643221690 Bacteria 4654705
130 2730228166 2728369380 Bacteria 3620317
131 2738713141 2738541275 Bacteria 4830863
132 2738713145 2738541275 Bacteria 4830863
133 2738851564 2738541301 Bacteria 4834102
134 2738851568 2738541301 Bacteria 4834102
135 2738867295 2738541304 Bacteria 4833665
136 2738867299 2738541304 Bacteria 4833665
137 2739299811 2738543022 Bacteria 4835059
138 2739299815 2738543022 Bacteria 4835059
139 2739361491 2738543033 Bacteria 4833336
140 2739361495 2738543033 Bacteria 4833336
141 2753039920 2751185725 Bacteria 5740550
142 2753328493 2751185792 Bacteria 5739090
143 2856288246 2856287931 Bacteria 7223934
144 2919710094 2919709256 Bacteria 4318106
145 2928104679 2928100450 Bacteria 4837635
146 2928104683 2928100450 Bacteria 4837635
147 2929215950 2929212328 Bacteria 7708288
148 2939585556 2939582691 Bacteria 7088898
149 2939659201 2939657138 Bacteria 3740283
150 3000865529 3000865235 Bacteria 3106258
151 3000865533 3000865235 Bacteria 3106258
152 8020942115 8020938398 Bacteria 7472757
153 8054921430 8054920844 Bacteria 7068637
154 Ga0182008_10032895
155 JGI24746J21847_1002392
156 rootH1_10090708
157 Ga0055538_1000708
158 Ga0070666_10399283
159 Ga0070671_100136597
160 Ga0070681_10293699
161 Ga0070665_100007349
162 Ga0068855_100522918
163 Ga0068856_100157298
164 Ga0068859_100069740
165 Ga0068861_100062974
166 Ga0068861_100365310
167 Ga0068863_100015612
168 Ga0068863_100032554
169 Ga0068862_100065977
170 Ga0075365_10069787
171 Ga0075368_10034768
172 Ga0075364_10081454
173 Ga0075364_10165656
174 Ga0075367_10215349
175 Ga0097620_100069747
176 Ga0105240_10046278
177 Ga0105240_10241196
178 Ga0105240_10823099
179 Ga0114129_11064635
180 Ga0105248_10783499
181 Ga0105237_10013023
182 Ga0105249_10035116
183 Ga0157370_10080988
184 Ga0157370_10356795
185 Ga0163162_10256408
186 Ga0163163_10251143
187 Ga0182008_10002918
188 Ga0182008_10033353
189 Ga0182008_10129123
190 Ga0157379_10014080
191 Ga0157379_10083264
192 Ga0157376_10138596
193 Ga0182007_10008010
194 Ga0182007_10016045
195 Ga0182007_10023621
196 Ga0182007_10027696
197 Ga0213872_10003782
198 Ga0213872_10005063
199 Ga0213876_10008049
200 Ga0213876_10040435
201 Ga0213876_10258071
202 Ga0209784_100645
203 Ga0207697_10145158
204 Ga0207644_10112980
205 Ga0207667_10275730
206 Ga0207668_10031720
207 Ga0207658_10210096
208 Ga0207703_10284548
209 Ga0207702_10167450
210 Ga0207641_10653007
211 Ga0207675_100012247
212 Ga0207675_100056361
213 Ga0268266_10007821
214 Ga0268264_10053388
215 Ga0307509_10000016
216 Ga0316576_10127899
217 Ga0307516_10000142
218 Ga0307410_10196031
219 Ga0307510_10260438
220 Ga0395901_0890142
221 Ga0436365_0142660
222 Ga0436365_0200691
223 Ga0436365_0641432
224 Ga0436365_1217634
225 Ga0436361_0103354
226 Ga0436361_0288677
227 Ga0439465_0003986
228 Ga0439442_014945
229 Ga0439445_0009700
230 Ga0439434_0009487
231 Ga0439435_0015109
232 Ga0466972_0031362
233 Ga0466973_0305347
234 Ga0466971_0136956
235 Ga0495627_000909
236 Ga0495650_0001795
237 Ga0495582_0013463
238 Ga0495632_0009187
239 Ga0495665_0066471
240 Ga0495633_0082381
241 Ga0495633_0093119
242 Ga0495625_0001276
243 Ga0495671_0008435
244 Ga0495581_0139885
245 Ga0495681_0001248
246 Ga0495686_0001043
247 Ga0496100_0021633
248 Ga0496100_0630960
249 Ga0496101_0073696
250 Ga0496101_0266676
251 Ga0496102_0617351
252 Ga0496103_0054529
253 Ga0496104_0016978
254 Ga0496104_0129142
255 Ga0496106_0123691
256 Ga0496106_0244853
257 Ga0496107_0043552
258 Ga0496108_0014313
259 Ga0496108_0737053
260 Ga0496109_0011056
261 Ga0496110_0067518
262 Ga0496110_0107055
263 Ga0496111_0076783
264 Ga0496112_0387742
265 Ga0496113_0075510
266 Ga0496115_0301224
267 Ga0496118_0234560
268 Ga0496126_0235217
269 Ga0495678_072511
270 Ga0501035_0611839
271 Ga0501044_0072119
272 nmdc:mga03n38_241505_c1
273 nmdc:mga00v17_66922_c1
274 nmdc:mga0yw44_110568_c1
275 nmdc:mga07m45_20378_c1
276 Ga0500635_0005017
277 Ga0466962_0034218
278 2579855609
279 2588234181
280 2619855337
281 2620351729
282 2644502970
283 2730228166
284 2738713141
285 2738713145
286 2738851564
287 2738851568
288 2738867295
289 2738867299
290 2739299811
291 2739299815
292 2739361491
293 2739361495
294 2753039920
295 2753328493
296 2856288246
297 2919710094
298 2928104679
299 2928104683
300 2929215950
301 2939585556
302 2939659201
303 3000865529
304 3000865533
305 8020942115
306 8054921430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

32

223

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

38

271

0.96

PF08659

KR

KR domain

33

187

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.975 1 244
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.9711 1 244
2hsd-assembly1.cif.gz_A the refined three-dimensional structure of 3alpha,20beta-hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases 0.9709 3 240
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9705 4 237
6y1b-assembly1.cif.gz_B x-ray structure of lactobacillus brevis alcohol dehydrogenase mutant k32a_q126k 0.969 3 240
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9916 3 90 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9772 4 183 3.40.50.720
1nfrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.974 1 244 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9725 2 237 3.40.50.720
2hsdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9709 3 240 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1V3X541-F1-model_v4 3-alpha-(Or 20-beta)-hydroxysteroid dehydrogenase (EC 1.1.1.53) 0.9962 1 179 GO:0047044
AF-X8FGA4-F1-model_v4 deleted 0.9958 1 242
AF-A0A7I7RUG8-F1-model_v4 3-alpha-hydroxysteroid dehydrogenase 0.9896 1 245 GO:0016491
AF-A0A100VWI7-F1-model_v4 20-beta-hydroxysteroid dehydrogenase 0.9877 19 245 GO:0016616
AF-A0A6N4W5V6-F1-model_v4 3-alpha-hydroxysteroid dehydrogenase 0.9876 26 245 GO:0016491

Map