F222258

General Info

Members Datasets Scaffolds Average Seq Length
155 58 310 79

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_12117238|Ga0157369_121172382
Length 90
Sequence MIDNDSLTALIRAEIPDAQVHIVDRTGTMDHFNVTVRSQAFAEKTLIEQHQLVYGALKAALKDGRVHAVELKTLPLGLGGPSIPQGDRYS

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
5 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
6 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
7 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
8 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
9 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
10 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
11 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
12 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
13 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
14 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
15 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
20 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
21 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
23 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
24 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
25 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
26 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
27 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
28 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
29 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
30 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
31 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
32 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
33 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
34 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
42 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
43 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
44 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
56 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 3.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 85.16
Stem 0
Stem Tuber 0
Unclassified 41.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_12117238 3300013105 Unclassified 570
2 Ga0070714_100025785 3300005435 Bacteria 4855
3 Ga0070714_100108273 3300005435 Bacteria 2457
4 Ga0070714_100141104 3300005435 Bacteria 2163
5 Ga0070714_100318579 3300005435 Unclassified 1454
6 Ga0070714_100456652 3300005435 Bacteria 1214
7 Ga0070714_100970921 3300005435 Unclassified 826
8 Ga0070713_100158600 3300005436 Bacteria 2018
9 Ga0070713_101206979 3300005436 Bacteria 732
10 Ga0070713_101877849 3300005436 Unclassified 581
11 Ga0070717_10482145 3300006028 Bacteria 1120
12 Ga0070712_101181206 3300006175 Unclassified 665
13 Ga0157369_10649313 3300013105 Bacteria 1088
14 Ga0157369_10841657 3300013105 Bacteria 942
15 Ga0157372_12811889 3300013307 Unclassified 558
16 Ga0206349_1126474 3300020075 Bacteria 546
17 Ga0213873_10003914 3300021358 Unclassified 2729
18 Ga0213873_10007150 3300021358 Unclassified 2225
19 Ga0213873_10032042 3300021358 Bacteria 1311
20 Ga0213873_10104741 3300021358 Unclassified 817
21 Ga0213873_10150689 3300021358 Unclassified 700
22 Ga0213872_10011510 3300021361 Bacteria 4184
23 Ga0213872_10011869 3300021361 Bacteria 4114
24 Ga0213872_10013157 3300021361 Unclassified 3879
25 Ga0213872_10018503 3300021361 Unclassified 3213
26 Ga0213872_10037344 3300021361 Unclassified 2218
27 Ga0213872_10075079 3300021361 Bacteria 1522
28 Ga0213872_10170673 3300021361 Bacteria 943
29 Ga0213872_10311482 3300021361 Unclassified 652
30 Ga0213874_10000377 3300021377 Bacteria 8797
31 Ga0213874_10084535 3300021377 Unclassified 1033
32 Ga0213874_10147284 3300021377 Bacteria 819
33 Ga0213876_10045758 3300021384 Unclassified 2314
34 Ga0213876_10046950 3300021384 Unclassified 2283
35 Ga0213875_10063428 3300021388 Bacteria 1728
36 Ga0213875_10126343 3300021388 Bacteria 1195
37 Ga0213875_10226955 3300021388 Unclassified 880
38 Ga0213875_10475911 3300021388 Unclassified 599
39 Ga0213871_10042129 3300021441 Bacteria 1229
40 Ga0213871_10055071 3300021441 Unclassified 1098
41 Ga0213871_10113276 3300021441 Bacteria 803
42 Ga0213871_10298344 3300021441 Bacteria 520
43 Ga0224712_10339457 3300022467 Unclassified 708
44 Ga0207693_10113564 3300025915 Unclassified 2125
45 Ga0207700_10433260 3300025928 Bacteria 1156
46 Ga0207664_10036611 3300025929 Bacteria 3793
47 Ga0207664_10129741 3300025929 Bacteria 2121
48 Ga0207664_10231971 3300025929 Unclassified 1605
49 Ga0207664_10357216 3300025929 Bacteria 1294
50 Ga0207664_10679142 3300025929 Bacteria 926
51 Ga0207664_10816498 3300025929 Unclassified 839
52 Ga0207664_11562585 3300025929 Unclassified 582
53 Ga0207690_10474596 3300025932 Unclassified 1009
54 Ga0265334_10044685 3300028573 Bacteria 1719
55 Ga0265338_10000606 3300028800 Bacteria 62890
56 Ga0265338_10118386 3300028800 Unclassified 2117
57 Ga0265338_10176120 3300028800 Bacteria 1635
58 Ga0265338_10440026 3300028800 Unclassified 924
59 Ga0265760_10361380 3300031090 Unclassified 521
60 Ga0265332_10012187 3300031238 Bacteria 3814
61 Ga0265328_10334101 3300031239 Bacteria 588
62 Ga0265325_10027426 3300031241 Bacteria 3078
63 Ga0265325_10157553 3300031241 Bacteria 1070
64 Ga0265329_10023579 3300031242 Bacteria 2049
65 Ga0265340_10018481 3300031247 Bacteria 3595
66 Ga0265340_10021290 3300031247 Bacteria 3326
67 Ga0265339_10006476 3300031249 Bacteria 7679
68 Ga0265339_10127176 3300031249 Bacteria 1306
69 Ga0265327_10016613 3300031251 Bacteria 4664
70 Ga0265316_10032456 3300031344 Bacteria 4261
71 Ga0265316_10173779 3300031344 Bacteria 1606
72 Ga0265313_10003429 3300031595 Bacteria 12832
73 Ga0265342_10002680 3300031712 Bacteria 15155
74 Ga0265342_10007422 3300031712 Bacteria 8028
75 Ga0373955_0330329 3300035172 Unclassified 922
76 Ga0373935_1305745 3300035692 Unclassified 542
77 Ga0373937_0090766 3300036401 Unclassified 2830
78 Ga0395899_0017785 3300037312 Bacteria 5412
79 Ga0395900_0094658 3300037418 Bacteria 3068
80 Ga0395900_0434244 3300037418 Bacteria 1272
81 Ga0395900_1621229 3300037418 Unclassified 558
82 Ga0395898_0017940 3300037466 Bacteria 7221
83 Ga0436364_0089408 3300037853 Unclassified 1044
84 Ga0436364_0273345 3300037853 Bacteria 2794207
85 Ga0436364_0404962 3300037853 Bacteria 1308
86 Ga0436364_0827391 3300037853 Unclassified 596
87 Ga0436364_0867534 3300037853 Unclassified 1732
88 Ga0436364_1263790 3300037853 Bacteria 3090
89 Ga0436364_1502536 3300037853 Bacteria 7167
90 Ga0395901_0024052 3300038443 Bacteria 6248
91 Ga0436365_0463588 3300039437 Bacteria 24445
92 Ga0436365_1292316 3300039437 Unclassified 3268
93 Ga0436360_0080943 3300039438 Unclassified 555
94 Ga0436360_0446513 3300039438 Bacteria 588
95 Ga0436360_0499009 3300039438 Bacteria 2204
96 Ga0436360_0564705 3300039438 Unclassified 689
97 Ga0436360_0661873 3300039438 Unclassified 558
98 Ga0436360_0694593 3300039438 Unclassified 1228
99 Ga0436360_0927951 3300039438 Unclassified 1265
100 Ga0436360_0938355 3300039438 Bacteria 7285
101 Ga0436360_1067013 3300039438 Unclassified 2806
102 Ga0436360_1106046 3300039438 Bacteria 832
103 Ga0436360_1151891 3300039438 Unclassified 519
104 Ga0436360_1243983 3300039438 Bacteria 642
105 Ga0436360_1266370 3300039438 Unclassified 525
106 Ga0436361_0300191 3300039447 Bacteria 5376
107 Ga0436361_0316810 3300039447 Bacteria 3750
108 Ga0436361_0330571 3300039447 Unclassified 666
109 Ga0436361_0361998 3300039447 Bacteria 21635
110 Ga0436361_0468352 3300039447 Bacteria 1384
111 Ga0436361_0490082 3300039447 Bacteria 5933
112 Ga0436361_0585417 3300039447 Unclassified 533
113 Ga0436361_0614079 3300039447 Bacteria 1658
114 Ga0436361_0625477 3300039447 Bacteria 2450
115 Ga0436361_0950629 3300039447 Bacteria 7903
116 Ga0436361_0997946 3300039447 Bacteria 2156
117 Ga0436361_1132474 3300039447 Bacteria 730
118 Ga0436361_1158199 3300039447 Bacteria 42248
119 Ga0436363_0304593 3300039450 Bacteria 3198
120 Ga0436363_0441833 3300039450 Unclassified 1642
121 Ga0436363_1027396 3300039450 Bacteria 8400
122 Ga0436363_1382565 3300039450 Bacteria 1702
123 Ga0436363_1439814 3300039450 Unclassified 921
124 Ga0436362_0003599 3300039453 Unclassified 573
125 Ga0436362_0004101 3300039453 Bacteria 31318
126 Ga0436362_0103281 3300039453 Unclassified 974
127 Ga0436362_0296403 3300039453 Unclassified 2608
128 Ga0436362_0410181 3300039453 Unclassified 704
129 Ga0436362_0498623 3300039453 Unclassified 792
130 Ga0436362_0553867 3300039453 Unclassified 516
131 Ga0436362_0623541 3300039453 Unclassified 1095
132 Ga0436362_0906954 3300039453 Bacteria 1247
133 Ga0436362_1146592 3300039453 Unclassified 621
134 Ga0436362_1156307 3300039453 Unclassified 1794
135 Ga0436362_1207007 3300039453 Bacteria 2562
136 Ga0436362_1257076 3300039453 Unclassified 829
137 Ga0466969_0230028 3300044656 Bacteria 842
138 Ga0466965_0854184 3300044683 Unclassified 529
139 Ga0466966_0021209 3300044684 Bacteria 4266
140 Ga0466963_0000876 3300044694 Bacteria 15263
141 Ga0466963_0062394 3300044694 Bacteria 2493
142 Ga0466968_0362165 3300044735 Unclassified 706
143 Ga0466968_0725611 3300044735 Bacteria 509
144 Ga0466970_0848201 3300044765 Bacteria 536
145 Ga0466957_0012859 3300044842 Bacteria 4851
146 Ga0466959_0233062 3300045049 Unclassified 1274
147 Ga0466959_0896392 3300045049 Bacteria 592
148 Ga0466958_0007732 3300045836 Bacteria 5929
149 Ga0466958_0020228 3300045836 Bacteria 3881
150 Ga0466967_0011640 3300045976 Bacteria 6680
151 Ga0466967_0128724 3300045976 Unclassified 2348
152 Ga0495601_0188783 3300053077 Bacteria 1347
153 Ga0587073_0069399 3300059492 Bacteria 847
154 Ga0587075_144647 3300059644 Unclassified 510
155 Ga0587114_132766 3300059655 Unclassified 514
156 Ga0157369_12117238
157 Ga0070714_100025785
158 Ga0070714_100108273
159 Ga0070714_100141104
160 Ga0070714_100318579
161 Ga0070714_100456652
162 Ga0070714_100970921
163 Ga0070713_100158600
164 Ga0070713_101206979
165 Ga0070713_101877849
166 Ga0070717_10482145
167 Ga0070712_101181206
168 Ga0157369_10649313
169 Ga0157369_10841657
170 Ga0157372_12811889
171 Ga0206349_1126474
172 Ga0213873_10003914
173 Ga0213873_10007150
174 Ga0213873_10032042
175 Ga0213873_10104741
176 Ga0213873_10150689
177 Ga0213872_10011510
178 Ga0213872_10011869
179 Ga0213872_10013157
180 Ga0213872_10018503
181 Ga0213872_10037344
182 Ga0213872_10075079
183 Ga0213872_10170673
184 Ga0213872_10311482
185 Ga0213874_10000377
186 Ga0213874_10084535
187 Ga0213874_10147284
188 Ga0213876_10045758
189 Ga0213876_10046950
190 Ga0213875_10063428
191 Ga0213875_10126343
192 Ga0213875_10226955
193 Ga0213875_10475911
194 Ga0213871_10042129
195 Ga0213871_10055071
196 Ga0213871_10113276
197 Ga0213871_10298344
198 Ga0224712_10339457
199 Ga0207693_10113564
200 Ga0207700_10433260
201 Ga0207664_10036611
202 Ga0207664_10129741
203 Ga0207664_10231971
204 Ga0207664_10357216
205 Ga0207664_10679142
206 Ga0207664_10816498
207 Ga0207664_11562585
208 Ga0207690_10474596
209 Ga0265334_10044685
210 Ga0265338_10000606
211 Ga0265338_10118386
212 Ga0265338_10176120
213 Ga0265338_10440026
214 Ga0265760_10361380
215 Ga0265332_10012187
216 Ga0265328_10334101
217 Ga0265325_10027426
218 Ga0265325_10157553
219 Ga0265329_10023579
220 Ga0265340_10018481
221 Ga0265340_10021290
222 Ga0265339_10006476
223 Ga0265339_10127176
224 Ga0265327_10016613
225 Ga0265316_10032456
226 Ga0265316_10173779
227 Ga0265313_10003429
228 Ga0265342_10002680
229 Ga0265342_10007422
230 Ga0373955_0330329
231 Ga0373935_1305745
232 Ga0373937_0090766
233 Ga0395899_0017785
234 Ga0395900_0094658
235 Ga0395900_0434244
236 Ga0395900_1621229
237 Ga0395898_0017940
238 Ga0436364_0089408
239 Ga0436364_0273345
240 Ga0436364_0404962
241 Ga0436364_0827391
242 Ga0436364_0867534
243 Ga0436364_1263790
244 Ga0436364_1502536
245 Ga0395901_0024052
246 Ga0436365_0463588
247 Ga0436365_1292316
248 Ga0436360_0080943
249 Ga0436360_0446513
250 Ga0436360_0499009
251 Ga0436360_0564705
252 Ga0436360_0661873
253 Ga0436360_0694593
254 Ga0436360_0927951
255 Ga0436360_0938355
256 Ga0436360_1067013
257 Ga0436360_1106046
258 Ga0436360_1151891
259 Ga0436360_1243983
260 Ga0436360_1266370
261 Ga0436361_0300191
262 Ga0436361_0316810
263 Ga0436361_0330571
264 Ga0436361_0361998
265 Ga0436361_0468352
266 Ga0436361_0490082
267 Ga0436361_0585417
268 Ga0436361_0614079
269 Ga0436361_0625477
270 Ga0436361_0950629
271 Ga0436361_0997946
272 Ga0436361_1132474
273 Ga0436361_1158199
274 Ga0436363_0304593
275 Ga0436363_0441833
276 Ga0436363_1027396
277 Ga0436363_1382565
278 Ga0436363_1439814
279 Ga0436362_0003599
280 Ga0436362_0004101
281 Ga0436362_0103281
282 Ga0436362_0296403
283 Ga0436362_0410181
284 Ga0436362_0498623
285 Ga0436362_0553867
286 Ga0436362_0623541
287 Ga0436362_0906954
288 Ga0436362_1146592
289 Ga0436362_1156307
290 Ga0436362_1207007
291 Ga0436362_1257076
292 Ga0466969_0230028
293 Ga0466965_0854184
294 Ga0466966_0021209
295 Ga0466963_0000876
296 Ga0466963_0062394
297 Ga0466968_0362165
298 Ga0466968_0725611
299 Ga0466970_0848201
300 Ga0466957_0012859
301 Ga0466959_0233062
302 Ga0466959_0896392
303 Ga0466958_0007732
304 Ga0466958_0020228
305 Ga0466967_0011640
306 Ga0466967_0128724
307 Ga0495601_0188783
308 Ga0587073_0069399
309 Ga0587075_144647
310 Ga0587114_132766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

7

76

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8879 2 73
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8854 3 77
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8743 3 77
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8478 1 77
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8255 1 75
ID Description Score Start End Superfamily
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9337 2 75 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9102 5 75 3.10.20.90
af_O14280_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8994 1 75 3.30.300.90
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8927 7 77 3.30.300.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8896 2 75 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A0R0MGN0-F1-model_v4 BolA family transcriptional regulator 0.9837 1 76
AF-A0A845K3G4-F1-model_v4 BolA family transcriptional regulator 0.9833 1 76
AF-A0A7V9M9E2-F1-model_v4 BolA family transcriptional regulator 0.9811 19 76
AF-A0A2W7B6Y1-F1-model_v4 BolA family transcriptional regulator 0.9774 1 77
AF-A0A6L5C4I1-F1-model_v4 deleted 0.9754 1 77

Map