F222109

General Info

Members Datasets Scaffolds Average Seq Length
155 115 310 134

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10005133|Ga0111539_100051332
Length 161
Sequence MGTLKYRLVAATSRYYSRCMTSSARLFRVIMPVANIDEGARFYSALLDNPGFRISGGRHYFQCGPVILAVYDATADGDPATGKIRSNPQHVYFAVPDLRAAFARAQKLGGLLSEMGDGGLPMGEIARRPWGEVSFYLDDPWGNPLCFVDETSIFRGPSVPA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
113 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 1.94
Rhizosphere 92.26
Stem 0
Stem Tuber 0
Unclassified 29.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10005133 3300009094 Bacteria 16977
2 JGI24739J22299_10119476 3300001989 Bacteria 788
3 Ga0070676_10009045 3300005328 Bacteria 5390
4 Ga0070676_10110672 3300005328 Unclassified 1710
5 Ga0070676_10915645 3300005328 Bacteria 654
6 Ga0070683_100331581 3300005329 Bacteria 1448
7 Ga0070677_10054217 3300005333 Bacteria 1633
8 Ga0070682_100004835 3300005337 Bacteria 7481
9 Ga0070689_100449401 3300005340 Bacteria 1096
10 Ga0070692_10994308 3300005345 Unclassified 586
11 Ga0070675_101135007 3300005354 Bacteria 719
12 Ga0070674_100047846 3300005356 Bacteria 2933
13 Ga0070688_100002364 3300005365 Bacteria 9522
14 Ga0070700_100103586 3300005441 Unclassified 1879
15 Ga0070694_100282229 3300005444 Bacteria 1266
16 Ga0070663_100012760 3300005455 Bacteria 5328
17 Ga0070678_100388616 3300005456 Unclassified 1209
18 Ga0070678_100894701 3300005456 Bacteria 811
19 Ga0068867_100931505 3300005459 Bacteria 784
20 Ga0070685_10125349 3300005466 Unclassified 1599
21 Ga0070685_10467993 3300005466 Bacteria 886
22 Ga0070684_100241455 3300005535 Bacteria 1651
23 Ga0070684_101017663 3300005535 Bacteria 778
24 Ga0068853_100017305 3300005539 Bacteria 5951
25 Ga0070672_100107827 3300005543 Bacteria 2267
26 Ga0070672_100399465 3300005543 Bacteria 1178
27 Ga0070672_100676026 3300005543 Bacteria 903
28 Ga0070686_100000056 3300005544 Bacteria 87537
29 Ga0070665_100000497 3300005548 Bacteria 56270
30 Ga0070665_100003615 3300005548 Bacteria 16375
31 Ga0070704_100170758 3300005549 Unclassified 1729
32 Ga0068857_101329141 3300005577 Bacteria 698
33 Ga0068854_100151076 3300005578 Unclassified 1791
34 Ga0068852_100796645 3300005616 Bacteria 959
35 Ga0068859_100021462 3300005617 Bacteria 6482
36 Ga0068859_100510422 3300005617 Bacteria 1297
37 Ga0068859_100672389 3300005617 Bacteria 1127
38 Ga0068861_100301981 3300005719 Bacteria 1387
39 Ga0068870_10128193 3300005840 Bacteria 1470
40 Ga0068858_100203357 3300005842 Bacteria 1873
41 Ga0068860_100012470 3300005843 Bacteria 8370
42 Ga0068860_100275471 3300005843 Bacteria 1643
43 Ga0081455_10097038 3300005937 Bacteria 2375
44 Ga0075428_100345649 3300006844 Unclassified 1597
45 Ga0075428_100525939 3300006844 Bacteria 1265
46 Ga0075428_100635646 3300006844 Unclassified 1139
47 Ga0075428_100766889 3300006844 Unclassified 1026
48 Ga0075431_100138903 3300006847 Bacteria 2505
49 Ga0075431_100719466 3300006847 Bacteria 975
50 Ga0075434_101094796 3300006871 Unclassified 810
51 Ga0075429_100080941 3300006880 Bacteria 2832
52 Ga0097620_100021462 3300006931 Bacteria 6482
53 Ga0097620_100510427 3300006931 Bacteria 1297
54 Ga0097620_100672421 3300006931 Bacteria 1127
55 Ga0105240_10768605 3300009093 Bacteria 1046
56 Ga0111539_10799862 3300009094 Bacteria 1097
57 Ga0111539_12878714 3300009094 Bacteria 557
58 Ga0114129_10064371 3300009147 Bacteria 5116
59 Ga0114129_10372418 3300009147 Bacteria 1887
60 Ga0105243_10345059 3300009148 Bacteria 1365
61 Ga0105238_10133625 3300009551 Bacteria 2459
62 Ga0157369_10005411 3300013105 Bacteria 14863
63 Ga0157378_10393853 3300013297 Eukaryota 1363
64 Ga0157380_10006835 3300014326 Bacteria 8062
65 Ga0157380_10165232 3300014326 Bacteria 1928
66 Ga0157379_10032848 3300014968 Bacteria 4627
67 Ga0206356_10512254 3300020070 Bacteria 2888
68 Ga0213876_10003532 3300021384 Bacteria 8915
69 Ga0207657_10210376 3300025919 Bacteria 1561
70 Ga0207649_10305568 3300025920 Bacteria 1164
71 Ga0207681_10606604 3300025923 Bacteria 905
72 Ga0207694_10415929 3300025924 Bacteria 1119
73 Ga0207687_10688075 3300025927 Bacteria 867
74 Ga0207706_10332311 3300025933 Unclassified 1322
75 Ga0207670_11354647 3300025936 Unclassified 604
76 Ga0207691_10129492 3300025940 Bacteria 2230
77 Ga0207691_10209946 3300025940 Bacteria 1692
78 Ga0207661_10930725 3300025944 Archaea 801
79 Ga0207667_11544564 3300025949 Unclassified 634
80 Ga0207640_10666138 3300025981 Unclassified 888
81 Ga0207658_11034885 3300025986 Bacteria 749
82 Ga0207658_11462194 3300025986 Unclassified 625
83 Ga0207703_10845859 3300026035 Unclassified 875
84 Ga0207703_11143777 3300026035 Unclassified 748
85 Ga0207639_10048478 3300026041 Bacteria 3215
86 Ga0207639_10422066 3300026041 Bacteria 1206
87 Ga0207678_10013232 3300026067 Bacteria 7240
88 Ga0207708_10041092 3300026075 Unclassified 3526
89 Ga0207708_10087591 3300026075 Unclassified 2398
90 Ga0207708_10159145 3300026075 Unclassified 1783
91 Ga0207708_11648147 3300026075 Bacteria 563
92 Ga0207674_10360403 3300026116 Bacteria 1405
93 Ga0207675_100910254 3300026118 Bacteria 896
94 Ga0207675_101526701 3300026118 Bacteria 689
95 Ga0207683_10417131 3300026121 Unclassified 1236
96 Ga0207683_10710100 3300026121 Bacteria 932
97 Ga0207698_11507823 3300026142 Bacteria 688
98 Ga0207428_10088111 3300027907 Unclassified 2414
99 Ga0268266_10000294 3300028379 Bacteria 81573
100 Ga0268266_10041076 3300028379 Bacteria 3944
101 Ga0268265_10764649 3300028380 Unclassified 939
102 Ga0268264_10013269 3300028381 Bacteria 6784
103 Ga0307513_10706550 3300031456 Unclassified 714
104 Ga0307408_100788991 3300031548 Unclassified 861
105 Ga0307407_10826734 3300031903 Unclassified 706
106 Ga0307409_101107438 3300031995 Bacteria 813
107 Ga0307416_100780808 3300032002 Unclassified 1050
108 Ga0307416_101175180 3300032002 Bacteria 873
109 Ga0307416_102722036 3300032002 Unclassified 591
110 Ga0307414_11279537 3300032004 Bacteria 680
111 Ga0307415_102239849 3300032126 Unclassified 535
112 Ga0436365_0905465 3300039437 Bacteria 11277
113 Ga0436363_0219331 3300039450 Bacteria 686
114 Ga0436362_1160030 3300039453 Unclassified 765
115 Ga0436362_1208060 3300039453 Bacteria 833
116 Ga0451800_0835326 3300041459 Unclassified 627
117 Ga0451807_0054130 3300041486 Bacteria 1421
118 Ga0439460_0066410 3300042461 Bacteria 1110
119 Ga0495616_0000024 3300046513 Bacteria 145530
120 Ga0495633_0347044 3300046558 Bacteria 673
121 Ga0495668_0003761 3300046616 Bacteria 11126
122 Ga0495668_0836637 3300046616 Unclassified 510
123 Ga0495625_0059593 3300046660 Bacteria 2708
124 Ga0495647_0059322 3300046681 Bacteria 1506
125 Ga0495686_0384791 3300047472 Unclassified 756
126 Ga0496107_1354965 3300048910 Bacteria 508
127 Ga0501033_0928222 3300049570 Bacteria 584
128 Ga0501041_0095554 3300049577 Bacteria 1837
129 Ga0501041_0242446 3300049577 Unclassified 1133
130 Ga0501042_0098105 3300049578 Bacteria 2107
131 Ga0501042_0183410 3300049578 Unclassified 1510
132 Ga0501046_0501512 3300049580 Unclassified 869
133 Ga0501068_0356652 3300049584 Unclassified 940
134 Ga0501072_0310375 3300049588 Bacteria 1254
135 Ga0501075_0305190 3300049591 Unclassified 1213
136 Ga0501077_0332780 3300049593 Unclassified 968
137 Ga0501077_0362646 3300049593 Unclassified 925
138 Ga0501079_0129833 3300049741 Unclassified 1961
139 Ga0501080_0230075 3300049742 Bacteria 1695
140 Ga0501045_0790707 3300049824 Bacteria 699
141 Ga0501212_073353 3300049851 Unclassified 609
142 nmdc:mga05p37_41376_c1 3300050507 Bacteria 5657
143 nmdc:mga09592_198958_c1 3300050508 Bacteria 1735
144 nmdc:mga09592_20243_c1 3300050508 Bacteria 5468
145 nmdc:mga06r32_161057_c1 3300050510 Bacteria 2226
146 nmdc:mga08y16_113256_c1 3300050511 Unclassified 2824
147 nmdc:mga08y16_172975_c1 3300050511 Unclassified 2243
148 nmdc:mga0n895_257231_c1 3300050512 Bacteria 1772
149 Ga0495619_0105888 3300053085 Bacteria 1918
150 Ga0500658_0269836 3300053134 Bacteria 782
151 Ga0500568_0002185 3300053139 Bacteria 11770
152 Ga0500573_0229686 3300053140 Bacteria 968
153 Ga0500604_0004187 3300053151 Bacteria 3841
154 Ga0500616_0000070 3300053153 Bacteria 232610
155 Ga0501084_0162903 3300054114 Bacteria 1881
156 Ga0111539_10005133
157 JGI24739J22299_10119476
158 Ga0070676_10009045
159 Ga0070676_10110672
160 Ga0070676_10915645
161 Ga0070683_100331581
162 Ga0070677_10054217
163 Ga0070682_100004835
164 Ga0070689_100449401
165 Ga0070692_10994308
166 Ga0070675_101135007
167 Ga0070674_100047846
168 Ga0070688_100002364
169 Ga0070700_100103586
170 Ga0070694_100282229
171 Ga0070663_100012760
172 Ga0070678_100388616
173 Ga0070678_100894701
174 Ga0068867_100931505
175 Ga0070685_10125349
176 Ga0070685_10467993
177 Ga0070684_100241455
178 Ga0070684_101017663
179 Ga0068853_100017305
180 Ga0070672_100107827
181 Ga0070672_100399465
182 Ga0070672_100676026
183 Ga0070686_100000056
184 Ga0070665_100000497
185 Ga0070665_100003615
186 Ga0070704_100170758
187 Ga0068857_101329141
188 Ga0068854_100151076
189 Ga0068852_100796645
190 Ga0068859_100021462
191 Ga0068859_100510422
192 Ga0068859_100672389
193 Ga0068861_100301981
194 Ga0068870_10128193
195 Ga0068858_100203357
196 Ga0068860_100012470
197 Ga0068860_100275471
198 Ga0081455_10097038
199 Ga0075428_100345649
200 Ga0075428_100525939
201 Ga0075428_100635646
202 Ga0075428_100766889
203 Ga0075431_100138903
204 Ga0075431_100719466
205 Ga0075434_101094796
206 Ga0075429_100080941
207 Ga0097620_100021462
208 Ga0097620_100510427
209 Ga0097620_100672421
210 Ga0105240_10768605
211 Ga0111539_10799862
212 Ga0111539_12878714
213 Ga0114129_10064371
214 Ga0114129_10372418
215 Ga0105243_10345059
216 Ga0105238_10133625
217 Ga0157369_10005411
218 Ga0157378_10393853
219 Ga0157380_10006835
220 Ga0157380_10165232
221 Ga0157379_10032848
222 Ga0206356_10512254
223 Ga0213876_10003532
224 Ga0207657_10210376
225 Ga0207649_10305568
226 Ga0207681_10606604
227 Ga0207694_10415929
228 Ga0207687_10688075
229 Ga0207706_10332311
230 Ga0207670_11354647
231 Ga0207691_10129492
232 Ga0207691_10209946
233 Ga0207661_10930725
234 Ga0207667_11544564
235 Ga0207640_10666138
236 Ga0207658_11034885
237 Ga0207658_11462194
238 Ga0207703_10845859
239 Ga0207703_11143777
240 Ga0207639_10048478
241 Ga0207639_10422066
242 Ga0207678_10013232
243 Ga0207708_10041092
244 Ga0207708_10087591
245 Ga0207708_10159145
246 Ga0207708_11648147
247 Ga0207674_10360403
248 Ga0207675_100910254
249 Ga0207675_101526701
250 Ga0207683_10417131
251 Ga0207683_10710100
252 Ga0207698_11507823
253 Ga0207428_10088111
254 Ga0268266_10000294
255 Ga0268266_10041076
256 Ga0268265_10764649
257 Ga0268264_10013269
258 Ga0307513_10706550
259 Ga0307408_100788991
260 Ga0307407_10826734
261 Ga0307409_101107438
262 Ga0307416_100780808
263 Ga0307416_101175180
264 Ga0307416_102722036
265 Ga0307414_11279537
266 Ga0307415_102239849
267 Ga0436365_0905465
268 Ga0436363_0219331
269 Ga0436362_1160030
270 Ga0436362_1208060
271 Ga0451800_0835326
272 Ga0451807_0054130
273 Ga0439460_0066410
274 Ga0495616_0000024
275 Ga0495633_0347044
276 Ga0495668_0003761
277 Ga0495668_0836637
278 Ga0495625_0059593
279 Ga0495647_0059322
280 Ga0495686_0384791
281 Ga0496107_1354965
282 Ga0501033_0928222
283 Ga0501041_0095554
284 Ga0501041_0242446
285 Ga0501042_0098105
286 Ga0501042_0183410
287 Ga0501046_0501512
288 Ga0501068_0356652
289 Ga0501072_0310375
290 Ga0501075_0305190
291 Ga0501077_0332780
292 Ga0501077_0362646
293 Ga0501079_0129833
294 Ga0501080_0230075
295 Ga0501045_0790707
296 Ga0501212_073353
297 nmdc:mga05p37_41376_c1
298 nmdc:mga09592_198958_c1
299 nmdc:mga09592_20243_c1
300 nmdc:mga06r32_161057_c1
301 nmdc:mga08y16_113256_c1
302 nmdc:mga08y16_172975_c1
303 nmdc:mga0n895_257231_c1
304 Ga0495619_0105888
305 Ga0500658_0269836
306 Ga0500568_0002185
307 Ga0500573_0229686
308 Ga0500604_0004187
309 Ga0500616_0000070
310 Ga0501084_0162903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

147

0.88

PF18029

Glyoxalase_6

Glyoxalase-like domain

28

148

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8347 5 122
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8321 3 122
4nb1-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8217 5 122
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8116 10 122
6a52-assembly1.cif.gz_A oxidase chap-h1 0.8092 5 129
ID Description Score Start End Superfamily
af_K7KBB9_206_354_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8355 6 54 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8296 63 123 3.30.720.110
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8262 5 56 3.10.180.10
af_B3DIV2_630_713_4.10.1240.30 Few Secondary Structures;Irregular;Hormone receptor fold; 0.8195 105 123 4.10.1240.30
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8179 5 54 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A4R2IKH9-F1-model_v4 Extradiol dioxygenase family protein 0.9848 2 129 GO:0051213
AF-A0A229H377-F1-model_v4 VOC domain-containing protein 0.9838 3 129
AF-A0A2V7W0P7-F1-model_v4 VOC domain-containing protein 0.9836 3 129
AF-A0A2V2RJW0-F1-model_v4 VOC domain-containing protein 0.9744 13 129
AF-A0A4R2IKH9-F1-model_v4 Extradiol dioxygenase family protein 0.9698 2 129 GO:0051213

Map