F222007

General Info

Members Datasets Scaffolds Average Seq Length
155 119 310 168

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100120023|Ga0075434_1001200232
Length 174
Sequence MTTENGTPTTQTKTEKATFGAGCFWQVEAAFREVPGVLDTAVGYEGGHVDNPTYEQVCTGTTGHTEVCEVTFDPDRVSYEDLVTKYLLEIHDPTQKNRQGPDFGFQYRSVVFAHSDGQAGAARGLIDRYQDRFSKPIVTEIEPAATFWRAEEYHQCYLEKRHSQGGLLSALLGR

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.87
Nodule 0
Rhizoplane 10.97
Rhizosphere 82.58
Stem 0
Stem Tuber 0
Unclassified 23.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100120023 3300006871 Bacteria 2644
2 JGI25407J50210_10091812 3300003373 Unclassified 751
3 Ga0068868_100036238 3300005338 Bacteria 3817
4 Ga0070674_100134457 3300005356 Bacteria 1848
5 Ga0070709_10096079 3300005434 Bacteria 1964
6 Ga0070709_10238317 3300005434 Unclassified 1305
7 Ga0070711_100443643 3300005439 Unclassified 1061
8 Ga0070700_100199251 3300005441 Unclassified 1405
9 Ga0070678_100058885 3300005456 Bacteria 2821
10 Ga0070678_100977775 3300005456 Unclassified 777
11 Ga0070704_101237461 3300005549 Unclassified 682
12 Ga0068856_100052486 3300005614 Bacteria 4020
13 Ga0068856_100571499 3300005614 Unclassified 1152
14 Ga0068866_10337576 3300005718 Unclassified 953
15 Ga0081455_10012029 3300005937 Bacteria 8658
16 Ga0081455_10023389 3300005937 Bacteria 5750
17 Ga0081455_10097525 3300005937 Bacteria 2368
18 Ga0081538_10000032 3300005981 Bacteria 122398
19 Ga0081538_10002055 3300005981 Bacteria 20085
20 Ga0081538_10116542 3300005981 Bacteria 1295
21 Ga0075365_10001717 3300006038 Bacteria 10149
22 Ga0075365_10216821 3300006038 Bacteria 1342
23 Ga0075364_10048950 3300006051 Bacteria 2755
24 Ga0070715_10050638 3300006163 Bacteria 1784
25 Ga0070716_100076198 3300006173 Bacteria 1987
26 Ga0070712_100473064 3300006175 Unclassified 1046
27 Ga0068871_100729990 3300006358 Unclassified 909
28 Ga0075428_100128096 3300006844 Bacteria 2762
29 Ga0075430_100660634 3300006846 Bacteria 862
30 Ga0075431_100000960 3300006847 Bacteria 25567
31 Ga0075431_100035106 3300006847 Bacteria 5164
32 Ga0075433_10048098 3300006852 Bacteria 3709
33 Ga0075434_100105648 3300006871 Bacteria 2826
34 Ga0075434_100560987 3300006871 Bacteria 1161
35 Ga0068865_100047099 3300006881 Bacteria 2961
36 Ga0075435_100176779 3300007076 Bacteria 1803
37 Ga0105240_10071344 3300009093 Bacteria 4296
38 Ga0111539_10003377 3300009094 Bacteria 21056
39 Ga0111539_10824830 3300009094 Bacteria 1079
40 Ga0105245_10007056 3300009098 Bacteria 9857
41 Ga0105245_11101112 3300009098 Bacteria 841
42 Ga0105247_10518118 3300009101 Unclassified 871
43 Ga0114129_10029684 3300009147 Bacteria 7743
44 Ga0114129_10150969 3300009147 Bacteria 3180
45 Ga0114129_11847228 3300009147 Bacteria 734
46 Ga0105243_11118118 3300009148 Bacteria 797
47 Ga0105241_10826815 3300009174 Unclassified 855
48 Ga0105238_10214924 3300009551 Bacteria 1899
49 Ga0105249_10691046 3300009553 Unclassified 1080
50 Ga0105239_10025101 3300010375 Bacteria 6565
51 Ga0105246_10116778 3300011119 Unclassified 1970
52 Ga0157370_10198434 3300013104 Bacteria 1862
53 Ga0163162_11600936 3300013306 Unclassified 743
54 Ga0157375_10179462 3300013308 Bacteria 2268
55 Ga0157379_10181413 3300014968 Unclassified 1902
56 Ga0157376_10053586 3300014969 Bacteria 3359
57 Ga0213876_10225691 3300021384 Unclassified 996
58 Ga0224712_10546279 3300022467 Bacteria 563
59 Ga0207688_10032918 3300025901 Bacteria 2865
60 Ga0207680_10921110 3300025903 Unclassified 626
61 Ga0207685_10104314 3300025905 Unclassified 1218
62 Ga0207695_10122835 3300025913 Bacteria 2562
63 Ga0207693_10326963 3300025915 Bacteria 1200
64 Ga0207663_10562373 3300025916 Unclassified 893
65 Ga0207687_10146154 3300025927 Bacteria 1799
66 Ga0207664_10340101 3300025929 Bacteria 1327
67 Ga0207686_10086542 3300025934 Unclassified 2058
68 Ga0207709_10430567 3300025935 Bacteria 1015
69 Ga0207669_10238647 3300025937 Bacteria 1346
70 Ga0207704_10086155 3300025938 Bacteria 2048
71 Ga0207665_10100308 3300025939 Bacteria 2020
72 Ga0207712_11285585 3300025961 Unclassified 654
73 Ga0207668_11302326 3300025972 Unclassified 654
74 Ga0207677_10117072 3300026023 Unclassified 1996
75 Ga0207702_10024038 3300026078 Bacteria 5056
76 Ga0207702_10210425 3300026078 Unclassified 1808
77 Ga0207683_10041545 3300026121 Bacteria 4015
78 Ga0265338_10250826 3300028800 Unclassified 1306
79 Ga0265762_1015070 3300030760 Bacteria 1398
80 Ga0265325_10005291 3300031241 Bacteria 8000
81 Ga0307408_100331253 3300031548 Bacteria 1286
82 Ga0307416_101974060 3300032002 Bacteria 686
83 Ga0395900_0051967 3300037418 Bacteria 4220
84 Ga0395900_0210600 3300037418 Bacteria 1963
85 Ga0395898_0058641 3300037466 Bacteria 3747
86 Ga0395898_0273985 3300037466 Bacteria 1609
87 Ga0395905_0050059 3300037471 Bacteria 3915
88 Ga0436364_0772177 3300037853 Bacteria 1542
89 Ga0395901_0051693 3300038443 Bacteria 4273
90 Ga0395901_0423981 3300038443 Bacteria 1364
91 Ga0395901_0434548 3300038443 Bacteria 1344
92 Ga0395901_0556625 3300038443 Bacteria 1162
93 Ga0436365_0672730 3300039437 Bacteria 3306
94 Ga0436365_1485594 3300039437 Unclassified 1486
95 Ga0436360_0094663 3300039438 Bacteria 3110
96 Ga0436360_0498566 3300039438 Bacteria 1442
97 Ga0436360_0545886 3300039438 Bacteria 949
98 Ga0436360_0731723 3300039438 Bacteria 1636
99 Ga0436360_1281242 3300039438 Unclassified 628
100 Ga0436361_0122800 3300039447 Bacteria 3148
101 Ga0436362_0650751 3300039453 Bacteria 7792
102 Ga0436362_0803219 3300039453 Bacteria 2213
103 Ga0436362_0989195 3300039453 Bacteria 542
104 Ga0439452_121071 3300042010 Bacteria 557
105 Ga0466967_2376573 3300045976 Bacteria 525
106 Ga0495603_0147219 3300046455 Unclassified 1369
107 Ga0495629_0295039 3300046459 Bacteria 1111
108 Ga0495641_0058666 3300046461 Unclassified 1741
109 Ga0495582_0096075 3300046473 Unclassified 1656
110 Ga0495594_0118658 3300046499 Unclassified 1495
111 Ga0495647_0212843 3300046681 Bacteria 851
112 Ga0496101_0123528 3300048904 Bacteria 1959
113 Ga0496102_0055260 3300048905 Bacteria 3620
114 Ga0496102_0227470 3300048905 Bacteria 1759
115 Ga0496102_1436412 3300048905 Unclassified 609
116 Ga0496103_0004224 3300048906 Bacteria 8719
117 Ga0496105_0012084 3300048908 Bacteria 6836
118 Ga0496106_0005108 3300048909 Bacteria 9722
119 Ga0496107_0025316 3300048910 Bacteria 4201
120 Ga0496107_0723850 3300048910 Unclassified 731
121 Ga0496108_0583286 3300048911 Unclassified 975
122 Ga0496109_0131339 3300048912 Bacteria 2337
123 Ga0496110_0085646 3300048913 Bacteria 2813
124 Ga0496111_0072671 3300048914 Bacteria 2503
125 Ga0496112_0743356 3300048915 Unclassified 907
126 Ga0496113_0064819 3300048916 Bacteria 2763
127 Ga0496114_0026491 3300048917 Bacteria 4746
128 Ga0496115_0012122 3300048918 Bacteria 6482
129 Ga0501318_053713 3300049534 Bacteria 604
130 Ga0501039_0461794 3300049575 Bacteria 997
131 Ga0501040_0122173 3300049576 Bacteria 1828
132 Ga0501041_0147206 3300049577 Bacteria 1470
133 Ga0501042_0428390 3300049578 Bacteria 959
134 Ga0501046_0595181 3300049580 Bacteria 785
135 Ga0501067_0014849 3300049583 Bacteria 4310
136 Ga0501071_1224213 3300049587 Bacteria 580
137 Ga0501072_0566270 3300049588 Bacteria 897
138 Ga0501075_0831152 3300049591 Bacteria 703
139 Ga0501076_0854000 3300049592 Bacteria 751
140 nmdc:mga00v17_17658_c1 3300050491 Bacteria 4043
141 nmdc:mga0yw44_1348_c1 3300050492 Bacteria 9727
142 nmdc:mga0yw44_187371_c1 3300050492 Bacteria 1364
143 nmdc:mga05p37_623376_c1 3300050507 Bacteria 1213
144 nmdc:mga09592_96769_c1 3300050508 Bacteria 2525
145 nmdc:mga0qj67_623147_c1 3300050509 Bacteria 862
146 nmdc:mga0qj67_71658_c1 3300050509 Bacteria 2766
147 nmdc:mga06r32_43308_c1 3300050510 Bacteria 4283
148 nmdc:mga06r32_66886_c1 3300050510 Bacteria 3469
149 nmdc:mga08y16_422100_c1 3300050511 Bacteria 1363
150 nmdc:mga0n895_1424525_c1 3300050512 Bacteria 661
151 nmdc:mga0n895_21494_c1 3300050512 Bacteria 6036
152 nmdc:mga0n895_359282_c1 3300050512 Bacteria 1475
153 nmdc:mga0rr50_155959_c1 3300050513 Bacteria 1849
154 nmdc:mga0a205_52431_c1 3300050515 Bacteria 3936
155 Ga0530510_0225790 3300061734 Bacteria 1393
156 Ga0075434_100120023
157 JGI25407J50210_10091812
158 Ga0068868_100036238
159 Ga0070674_100134457
160 Ga0070709_10096079
161 Ga0070709_10238317
162 Ga0070711_100443643
163 Ga0070700_100199251
164 Ga0070678_100058885
165 Ga0070678_100977775
166 Ga0070704_101237461
167 Ga0068856_100052486
168 Ga0068856_100571499
169 Ga0068866_10337576
170 Ga0081455_10012029
171 Ga0081455_10023389
172 Ga0081455_10097525
173 Ga0081538_10000032
174 Ga0081538_10002055
175 Ga0081538_10116542
176 Ga0075365_10001717
177 Ga0075365_10216821
178 Ga0075364_10048950
179 Ga0070715_10050638
180 Ga0070716_100076198
181 Ga0070712_100473064
182 Ga0068871_100729990
183 Ga0075428_100128096
184 Ga0075430_100660634
185 Ga0075431_100000960
186 Ga0075431_100035106
187 Ga0075433_10048098
188 Ga0075434_100105648
189 Ga0075434_100560987
190 Ga0068865_100047099
191 Ga0075435_100176779
192 Ga0105240_10071344
193 Ga0111539_10003377
194 Ga0111539_10824830
195 Ga0105245_10007056
196 Ga0105245_11101112
197 Ga0105247_10518118
198 Ga0114129_10029684
199 Ga0114129_10150969
200 Ga0114129_11847228
201 Ga0105243_11118118
202 Ga0105241_10826815
203 Ga0105238_10214924
204 Ga0105249_10691046
205 Ga0105239_10025101
206 Ga0105246_10116778
207 Ga0157370_10198434
208 Ga0163162_11600936
209 Ga0157375_10179462
210 Ga0157379_10181413
211 Ga0157376_10053586
212 Ga0213876_10225691
213 Ga0224712_10546279
214 Ga0207688_10032918
215 Ga0207680_10921110
216 Ga0207685_10104314
217 Ga0207695_10122835
218 Ga0207693_10326963
219 Ga0207663_10562373
220 Ga0207687_10146154
221 Ga0207664_10340101
222 Ga0207686_10086542
223 Ga0207709_10430567
224 Ga0207669_10238647
225 Ga0207704_10086155
226 Ga0207665_10100308
227 Ga0207712_11285585
228 Ga0207668_11302326
229 Ga0207677_10117072
230 Ga0207702_10024038
231 Ga0207702_10210425
232 Ga0207683_10041545
233 Ga0265338_10250826
234 Ga0265762_1015070
235 Ga0265325_10005291
236 Ga0307408_100331253
237 Ga0307416_101974060
238 Ga0395900_0051967
239 Ga0395900_0210600
240 Ga0395898_0058641
241 Ga0395898_0273985
242 Ga0395905_0050059
243 Ga0436364_0772177
244 Ga0395901_0051693
245 Ga0395901_0423981
246 Ga0395901_0434548
247 Ga0395901_0556625
248 Ga0436365_0672730
249 Ga0436365_1485594
250 Ga0436360_0094663
251 Ga0436360_0498566
252 Ga0436360_0545886
253 Ga0436360_0731723
254 Ga0436360_1281242
255 Ga0436361_0122800
256 Ga0436362_0650751
257 Ga0436362_0803219
258 Ga0436362_0989195
259 Ga0439452_121071
260 Ga0466967_2376573
261 Ga0495603_0147219
262 Ga0495629_0295039
263 Ga0495641_0058666
264 Ga0495582_0096075
265 Ga0495594_0118658
266 Ga0495647_0212843
267 Ga0496101_0123528
268 Ga0496102_0055260
269 Ga0496102_0227470
270 Ga0496102_1436412
271 Ga0496103_0004224
272 Ga0496105_0012084
273 Ga0496106_0005108
274 Ga0496107_0025316
275 Ga0496107_0723850
276 Ga0496108_0583286
277 Ga0496109_0131339
278 Ga0496110_0085646
279 Ga0496111_0072671
280 Ga0496112_0743356
281 Ga0496113_0064819
282 Ga0496114_0026491
283 Ga0496115_0012122
284 Ga0501318_053713
285 Ga0501039_0461794
286 Ga0501040_0122173
287 Ga0501041_0147206
288 Ga0501042_0428390
289 Ga0501046_0595181
290 Ga0501067_0014849
291 Ga0501071_1224213
292 Ga0501072_0566270
293 Ga0501075_0831152
294 Ga0501076_0854000
295 nmdc:mga00v17_17658_c1
296 nmdc:mga0yw44_1348_c1
297 nmdc:mga0yw44_187371_c1
298 nmdc:mga05p37_623376_c1
299 nmdc:mga09592_96769_c1
300 nmdc:mga0qj67_623147_c1
301 nmdc:mga0qj67_71658_c1
302 nmdc:mga06r32_43308_c1
303 nmdc:mga06r32_66886_c1
304 nmdc:mga08y16_422100_c1
305 nmdc:mga0n895_1424525_c1
306 nmdc:mga0n895_21494_c1
307 nmdc:mga0n895_359282_c1
308 nmdc:mga0rr50_155959_c1
309 nmdc:mga0a205_52431_c1
310 Ga0530510_0225790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

16

166

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9717 4 149
3bqf-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) 0.9656 3 149
6yev-assembly4.cif.gz_D crystal structure of msra c206 and trx c35s complex from escherichia coli 0.9648 4 151
3bqe-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (reduced form) 0.9644 3 151
3bqg-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) 0.9602 3 151
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9761 5 149 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9757 4 151 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9566 5 149 3.30.1060.10
4lwkB00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9542 3 146 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9534 4 149 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A2V6KNQ5-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9793 3 140 GO:0008113
GO:0033744
GO:0036211
AF-F8L712-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9789 5 151 GO:0008113
GO:0033744
GO:0036211
AF-A0A535SBV2-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9788 3 151 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A7C1TD06-F1-model_v4 deleted 0.9785 1 146
AF-A0A3C1VC84-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9782 1 130 GO:0008113

Map