F221797

General Info

Members Datasets Scaffolds Average Seq Length
155 130 310 149

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100721351|Ga0068856_1007213512
Length 154
Sequence MFSQTVEYALRAVVHLAYIAPEAHTTAEIAEATKVPKDYLSKILQGLAKEGLVRTQRGVGGGVALAKDPAELTILDVVKAVEPESVRRMTTCPLGLRTHGVRLCPLHKRLDDAVALVEAAFRNTTLAEVLAEPSESVPLCETPDDAKLKLRKRQ

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
119 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
130 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 1.94
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 7.1
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 32.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100721351 3300005614 Unclassified 1017
2 MRS1b_contig_6321587 2162886011 Unclassified 2884
3 Ga0065707_10096657 3300005295 Unclassified 3247
4 Ga0070683_100044173 3300005329 Bacteria 4109
5 Ga0070690_100635039 3300005330 Unclassified 814
6 Ga0070671_100123319 3300005355 Unclassified 2181
7 Ga0070673_100052516 3300005364 Archaea 3198
8 Ga0070688_100314226 3300005365 Unclassified 1136
9 Ga0070688_100935536 3300005365 Bacteria 685
10 Ga0070714_102026731 3300005435 Unclassified 561
11 Ga0070700_100714142 3300005441 Unclassified 798
12 Ga0070700_100753548 3300005441 Unclassified 779
13 Ga0070694_101159355 3300005444 Unclassified 646
14 Ga0070678_100919827 3300005456 Bacteria 800
15 Ga0070685_10042596 3300005466 Bacteria 2591
16 Ga0070698_100294830 3300005471 Unclassified 1553
17 Ga0070684_100172940 3300005535 Bacteria 1962
18 Ga0068853_100111163 3300005539 Bacteria 2434
19 Ga0070672_100659331 3300005543 Bacteria 914
20 Ga0070665_100000158 3300005548 Bacteria 124017
21 Ga0070665_100020463 3300005548 Bacteria 6645
22 Ga0068857_101181663 3300005577 Bacteria 740
23 Ga0068859_100147135 3300005617 Bacteria 2431
24 Ga0068864_101249949 3300005618 Unclassified 742
25 Ga0068863_100867121 3300005841 Bacteria 902
26 Ga0068858_100148970 3300005842 Bacteria 2199
27 Ga0068860_100112188 3300005843 Bacteria 2607
28 Ga0068860_101897381 3300005843 Unclassified 617
29 Ga0068862_102694017 3300005844 Unclassified 509
30 Ga0081455_10146357 3300005937 Bacteria 1827
31 Ga0081539_10052553 3300005985 Bacteria 2287
32 Ga0070717_10068678 3300006028 Bacteria 2950
33 Ga0075363_100442603 3300006048 Unclassified 767
34 Ga0097621_101468556 3300006237 Unclassified 646
35 Ga0075428_100002998 3300006844 Bacteria 18421
36 Ga0075430_100449569 3300006846 Bacteria 1063
37 Ga0075429_100770681 3300006880 Bacteria 843
38 Ga0097620_100147138 3300006931 Bacteria 2431
39 Ga0105240_12192980 3300009093 Unclassified 573
40 Ga0111539_10416486 3300009094 Bacteria 1565
41 Ga0105247_10137973 3300009101 Unclassified 1595
42 Ga0105242_10795211 3300009176 Unclassified 936
43 Ga0105248_10968785 3300009177 Unclassified 961
44 Ga0105238_10000036 3300009551 Bacteria 165343
45 Ga0105249_10314374 3300009553 Bacteria 1576
46 Ga0105249_10395080 3300009553 Unclassified 1412
47 Ga0105249_11227114 3300009553 Unclassified 821
48 Ga0157374_10155251 3300013296 Bacteria 2227
49 Ga0157374_10510383 3300013296 Bacteria 1207
50 Ga0157372_11044883 3300013307 Bacteria 945
51 Ga0163163_10066044 3300014325 Bacteria 3592
52 Ga0163163_11310382 3300014325 Bacteria 786
53 Ga0163163_11488034 3300014325 Bacteria 738
54 Ga0213873_10105128 3300021358 Unclassified 815
55 Ga0213872_10012607 3300021361 Bacteria 3974
56 Ga0213876_10104129 3300021384 Bacteria 1505
57 Ga0213871_10001962 3300021441 Bacteria 3650
58 Ga0213871_10157308 3300021441 Bacteria 694
59 Ga0224712_10549975 3300022467 Bacteria 561
60 Ga0207694_10014985 3300025924 Bacteria 5845
61 Ga0207700_10185525 3300025928 Bacteria 1745
62 Ga0207644_10099517 3300025931 Unclassified 2182
63 Ga0207661_10025551 3300025944 Bacteria 4491
64 Ga0207667_11719875 3300025949 Unclassified 593
65 Ga0207651_10229343 3300025960 Bacteria 1506
66 Ga0207651_11076327 3300025960 Unclassified 720
67 Ga0207712_11018981 3300025961 Unclassified 735
68 Ga0207703_10381549 3300026035 Unclassified 1304
69 Ga0207641_10568292 3300026088 Bacteria 1107
70 Ga0207698_11094373 3300026142 Bacteria 809
71 Ga0268266_10000296 3300028379 Bacteria 80995
72 Ga0268266_10048773 3300028379 Bacteria 3630
73 Ga0268265_11632179 3300028380 Unclassified 650
74 Ga0268264_10062705 3300028381 Unclassified 3123
75 Ga0265338_10032911 3300028800 Bacteria 5045
76 Ga0265325_10003979 3300031241 Bacteria 9456
77 Ga0265339_10003226 3300031249 Bacteria 11445
78 Ga0265331_10000014 3300031250 Bacteria 294002
79 Ga0265313_10000047 3300031595 Bacteria 113587
80 Ga0265314_10000100 3300031711 Bacteria 131357
81 Ga0307406_11899219 3300031901 Bacteria 531
82 Ga0307407_10123037 3300031903 Bacteria 1648
83 Ga0307412_10344395 3300031911 Unclassified 1194
84 Ga0307416_100299814 3300032002 Bacteria 1597
85 Ga0307416_101032486 3300032002 Bacteria 926
86 Ga0373943_0036741 3300035170 Bacteria 2347
87 Ga0373946_0111614 3300035171 Bacteria 1238
88 Ga0373935_0565836 3300035692 Bacteria 829
89 Ga0373927_0042179 3300035695 Bacteria 2957
90 Ga0373947_0002839 3300035725 Bacteria 10342
91 Ga0373937_0599521 3300036401 Unclassified 1046
92 Ga0373937_0687507 3300036401 Bacteria 969
93 Ga0373937_1945241 3300036401 Unclassified 534
94 Ga0373925_0000339 3300037068 Bacteria 48683
95 Ga0395901_1773695 3300038443 Unclassified 567
96 Ga0436365_1142782 3300039437 Bacteria 1829
97 Ga0436360_0177749 3300039438 Bacteria 10826
98 Ga0436360_0699709 3300039438 Bacteria 1471
99 Ga0436361_0808269 3300039447 Bacteria 11503
100 Ga0436363_1402713 3300039450 Bacteria 1228
101 Ga0436362_1264637 3300039453 Bacteria 13412
102 Ga0466972_0178755 3300044658 Bacteria 995
103 Ga0495592_0362784 3300046454 Bacteria 926
104 Ga0495580_0314127 3300046472 Unclassified 1066
105 Ga0495628_0225682 3300046516 Bacteria 1405
106 Ga0495630_0415091 3300046517 Bacteria 1031
107 Ga0495652_0258143 3300046529 Bacteria 1288
108 Ga0495652_0323691 3300046529 Bacteria 1113
109 Ga0495587_0413704 3300046536 Bacteria 749
110 Ga0495645_0499127 3300046543 Bacteria 761
111 Ga0495667_0135342 3300046559 Bacteria 1588
112 Ga0495635_0402620 3300046663 Bacteria 909
113 Ga0495657_0202471 3300046675 Bacteria 1209
114 Ga0495646_0385978 3300046680 Bacteria 730
115 Ga0495624_0116643 3300046690 Bacteria 1640
116 Ga0495604_0180770 3300047317 Bacteria 1475
117 Ga0495674_1037607 3300047319 Bacteria 627
118 Ga0495672_0225382 3300047320 Bacteria 923
119 Ga0496104_0055965 3300048907 Bacteria 3729
120 Ga0496104_1408859 3300048907 Bacteria 600
121 Ga0496105_0054334 3300048908 Bacteria 3307
122 Ga0496106_1135823 3300048909 Unclassified 611
123 Ga0496109_0107051 3300048912 Bacteria 2597
124 Ga0496111_0832653 3300048914 Unclassified 667
125 Ga0496112_1550440 3300048915 Unclassified 576
126 Ga0496112_1625811 3300048915 Unclassified 559
127 Ga0496114_0279562 3300048917 Bacteria 1472
128 Ga0496114_0396481 3300048917 Bacteria 1222
129 Ga0496115_0159125 3300048918 Bacteria 1866
130 Ga0501307_007993 3300049162 Bacteria 1179
131 Ga0501292_036727 3300049515 Bacteria 837
132 Ga0501034_0668501 3300049571 Bacteria 939
133 Ga0501034_0741887 3300049571 Unclassified 878
134 Ga0501034_1308496 3300049571 Bacteria 601
135 Ga0501040_0538195 3300049576 Unclassified 843
136 Ga0501072_1220409 3300049588 Bacteria 584
137 Ga0501074_0624490 3300049590 Unclassified 762
138 Ga0501075_0904746 3300049591 Bacteria 671
139 Ga0501076_0427515 3300049592 Unclassified 1090
140 Ga0501209_200593 3300049656 Unclassified 614
141 Ga0501225_0055988 3300049705 Unclassified 1104
142 Ga0501079_1623349 3300049741 Unclassified 509
143 Ga0501080_0072044 3300049742 Bacteria 3215
144 Ga0501083_0100366 3300049744 Bacteria 1909
145 Ga0501044_0011131 3300049823 Bacteria 9756
146 Ga0501044_1560526 3300049823 Bacteria 525
147 nmdc:mga08y16_1380888_c1 3300050511 Unclassified 668
148 nmdc:mga08y16_252935_c1 3300050511 Unclassified 1820
149 Ga0495601_0034496 3300053077 Unclassified 3158
150 Ga0495601_0083098 3300053077 Bacteria 2056
151 Ga0495595_0318731 3300053084 Bacteria 783
152 Ga0587077_043165 3300059493 Bacteria 913
153 Ga0501082_0331077 3300060353 Unclassified 1327
154 Ga0530510_0536591 3300061734 Unclassified 888
155 2687236728 2684623219 Bacteria 8442773
156 Ga0068856_100721351
157 MRS1b_contig_6321587
158 Ga0065707_10096657
159 Ga0070683_100044173
160 Ga0070690_100635039
161 Ga0070671_100123319
162 Ga0070673_100052516
163 Ga0070688_100314226
164 Ga0070688_100935536
165 Ga0070714_102026731
166 Ga0070700_100714142
167 Ga0070700_100753548
168 Ga0070694_101159355
169 Ga0070678_100919827
170 Ga0070685_10042596
171 Ga0070698_100294830
172 Ga0070684_100172940
173 Ga0068853_100111163
174 Ga0070672_100659331
175 Ga0070665_100000158
176 Ga0070665_100020463
177 Ga0068857_101181663
178 Ga0068859_100147135
179 Ga0068864_101249949
180 Ga0068863_100867121
181 Ga0068858_100148970
182 Ga0068860_100112188
183 Ga0068860_101897381
184 Ga0068862_102694017
185 Ga0081455_10146357
186 Ga0081539_10052553
187 Ga0070717_10068678
188 Ga0075363_100442603
189 Ga0097621_101468556
190 Ga0075428_100002998
191 Ga0075430_100449569
192 Ga0075429_100770681
193 Ga0097620_100147138
194 Ga0105240_12192980
195 Ga0111539_10416486
196 Ga0105247_10137973
197 Ga0105242_10795211
198 Ga0105248_10968785
199 Ga0105238_10000036
200 Ga0105249_10314374
201 Ga0105249_10395080
202 Ga0105249_11227114
203 Ga0157374_10155251
204 Ga0157374_10510383
205 Ga0157372_11044883
206 Ga0163163_10066044
207 Ga0163163_11310382
208 Ga0163163_11488034
209 Ga0213873_10105128
210 Ga0213872_10012607
211 Ga0213876_10104129
212 Ga0213871_10001962
213 Ga0213871_10157308
214 Ga0224712_10549975
215 Ga0207694_10014985
216 Ga0207700_10185525
217 Ga0207644_10099517
218 Ga0207661_10025551
219 Ga0207667_11719875
220 Ga0207651_10229343
221 Ga0207651_11076327
222 Ga0207712_11018981
223 Ga0207703_10381549
224 Ga0207641_10568292
225 Ga0207698_11094373
226 Ga0268266_10000296
227 Ga0268266_10048773
228 Ga0268265_11632179
229 Ga0268264_10062705
230 Ga0265338_10032911
231 Ga0265325_10003979
232 Ga0265339_10003226
233 Ga0265331_10000014
234 Ga0265313_10000047
235 Ga0265314_10000100
236 Ga0307406_11899219
237 Ga0307407_10123037
238 Ga0307412_10344395
239 Ga0307416_100299814
240 Ga0307416_101032486
241 Ga0373943_0036741
242 Ga0373946_0111614
243 Ga0373935_0565836
244 Ga0373927_0042179
245 Ga0373947_0002839
246 Ga0373937_0599521
247 Ga0373937_0687507
248 Ga0373937_1945241
249 Ga0373925_0000339
250 Ga0395901_1773695
251 Ga0436365_1142782
252 Ga0436360_0177749
253 Ga0436360_0699709
254 Ga0436361_0808269
255 Ga0436363_1402713
256 Ga0436362_1264637
257 Ga0466972_0178755
258 Ga0495592_0362784
259 Ga0495580_0314127
260 Ga0495628_0225682
261 Ga0495630_0415091
262 Ga0495652_0258143
263 Ga0495652_0323691
264 Ga0495587_0413704
265 Ga0495645_0499127
266 Ga0495667_0135342
267 Ga0495635_0402620
268 Ga0495657_0202471
269 Ga0495646_0385978
270 Ga0495624_0116643
271 Ga0495604_0180770
272 Ga0495674_1037607
273 Ga0495672_0225382
274 Ga0496104_0055965
275 Ga0496104_1408859
276 Ga0496105_0054334
277 Ga0496106_1135823
278 Ga0496109_0107051
279 Ga0496111_0832653
280 Ga0496112_1550440
281 Ga0496112_1625811
282 Ga0496114_0279562
283 Ga0496114_0396481
284 Ga0496115_0159125
285 Ga0501307_007993
286 Ga0501292_036727
287 Ga0501034_0668501
288 Ga0501034_0741887
289 Ga0501034_1308496
290 Ga0501040_0538195
291 Ga0501072_1220409
292 Ga0501074_0624490
293 Ga0501075_0904746
294 Ga0501076_0427515
295 Ga0501209_200593
296 Ga0501225_0055988
297 Ga0501079_1623349
298 Ga0501080_0072044
299 Ga0501083_0100366
300 Ga0501044_0011131
301 Ga0501044_1560526
302 nmdc:mga08y16_1380888_c1
303 nmdc:mga08y16_252935_c1
304 Ga0495601_0034496
305 Ga0495601_0083098
306 Ga0495595_0318731
307 Ga0587077_043165
308 Ga0501082_0331077
309 Ga0530510_0536591
310 2687236728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

2

132

0.93

PF12802

MarR_2

MarR family

9

62

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xjf-assembly3.cif.gz_C x-ray crystal structure of pyrococcus furiosus general transcription factor tfe-alpha (semet labeled protein) 0.9386 20 71
6pln-assembly2.cif.gz_B x-ray crystal structure of pyrococcus furiosus general transcription factor tfe-alpha 0.9328 20 71
7kym-assembly1.cif.gz_A crystal structure of the marr family transcriptional regulator from bradyrhizobium japonicum 0.9227 21 67
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9093 20 78
6cda-assembly1.cif.gz_A-2 crystal structure of l34a czra in the zn(ii)bound state 0.9034 20 80
ID Description Score Start End Superfamily
af_Q9C106_417_505_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9537 21 69 1.10.10.10
af_Q5A246_423_511_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.946 21 69 1.10.10.10
af_Q8IG67_344_434_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9391 21 69 1.10.10.10
af_Q58088_26_109_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9251 20 80 1.10.10.10
af_Q4DKK4_76_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9199 25 80 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5Q4ELL8-F1-model_v4 Rrf2 family transcriptional regulator 0.9557 16 147 GO:0003700
GO:0005829
AF-A0A7Y2EC77-F1-model_v4 Rrf2 family transcriptional regulator 0.9476 15 141 GO:0003700
GO:0005829
AF-A0A0S8HTG1-F1-model_v4 Rrf2 family transcriptional regulator 0.9434 13 95 GO:0003700
GO:0005829
AF-A0A5B9W2J4-F1-model_v4 Transcriptional repressor NsrR 0.9358 15 153 GO:0003700
GO:0005829
AF-A0A5C6CD97-F1-model_v4 HTH-type transcriptional regulator CymR 0.9351 15 153 GO:0003700
GO:0005829

Map