F221158

General Info

Members Datasets Scaffolds Average Seq Length
155 130 310 289

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1016832|JGI25160J50197_10168322
Length 317
Sequence VTSVHALADYRGDGVQEFWEIAVGMPLNTTVRLFAGALLLITACTALARAEDEVRIQEEIWALPLPLPMFAYLVRPVGDGPFPLVIMNHGVSLNAKDRSFFPLVEFRDAAKWFAKRGNLVVAPVGSGYGAAAIDIPERGVYGPFFSKVGKCTNPNFRDAGLAVAQADLWIIDYLAAEKRITPKDVIVVGQSAGGWASIALSSVNPPPVKAIITFAAGRGGRVGDKPNNNCAPDKLVEATADFGRTSRLPMLWIYIENDTFFGPDLSKRMHAAFTTAGGNAEYHLVPPFGNEGHFFIGSADAIPIWSPLVSKFLDAQR

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
75 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
80 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
98 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
99 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
100 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
101 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
102 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
103 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
104 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
105 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
106 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
107 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
108 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
109 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
110 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
111 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
112 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
113 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
114 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
115 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
116 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
117 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
118 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
119 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
120 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
121 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
122 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
123 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
124 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
125 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
126 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
127 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
128 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
129 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
130 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.87
Metatranscriptomes 0
Isolates 16.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.77
Nodule 10.32
Rhizoplane 7.1
Rhizosphere 52.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1016832 3300003354 Bacteria 2340
2 JGI25153J46596_10000180 3300003215 Bacteria 62334
3 JGI25153J46596_10000200 3300003215 Bacteria 55694
4 JGI25153J46596_10000390 3300003215 Bacteria 29780
5 rootH2_10054602 3300003320 Bacteria 5119
6 rootH1_10083695 3300003323 Bacteria 1645
7 Ga0055543_1006347 3300004625 Bacteria 2867
8 Ga0065165_1002403 3300005262 Bacteria 15976
9 Ga0065165_1003135 3300005262 Bacteria 12211
10 Ga0070658_10153738 3300005327 Bacteria 1927
11 Ga0070682_100083824 3300005337 Bacteria 2070
12 Ga0070682_100324717 3300005337 Bacteria 1138
13 Ga0070660_100229616 3300005339 Bacteria 1510
14 Ga0070661_100375694 3300005344 Bacteria 1119
15 Ga0070696_100330955 3300005546 Bacteria 1175
16 Ga0070665_100014794 3300005548 Bacteria 7832
17 Ga0070665_100091037 3300005548 Bacteria 3055
18 Ga0070664_100103517 3300005564 Bacteria 2478
19 Ga0068856_100054526 3300005614 Bacteria 3943
20 Ga0068852_100030149 3300005616 Bacteria 4462
21 Ga0081455_10000855 3300005937 Bacteria 39247
22 Ga0081538_10003419 3300005981 Bacteria 15017
23 Ga0081538_10097547 3300005981 Bacteria 1493
24 Ga0075365_10034187 3300006038 Bacteria 3282
25 Ga0075365_10137225 3300006038 Bacteria 1696
26 Ga0070715_10012270 3300006163 Bacteria 3113
27 Ga0070712_100240332 3300006175 Bacteria 1442
28 Ga0105240_10020239 3300009093 Bacteria 8882
29 Ga0105247_10003634 3300009101 Bacteria 10016
30 Ga0105243_10339594 3300009148 Bacteria 1375
31 Ga0105241_10008542 3300009174 Bacteria 7532
32 Ga0105248_10025048 3300009177 Bacteria 6632
33 Ga0105237_10037228 3300009545 Bacteria 4919
34 Ga0105237_10214507 3300009545 Bacteria 1925
35 Ga0105238_10264417 3300009551 Bacteria 1700
36 Ga0105238_10323367 3300009551 Bacteria 1529
37 Ga0105239_10012754 3300010375 Bacteria 9350
38 Ga0105239_10370195 3300010375 Bacteria 1619
39 Ga0105239_10661130 3300010375 Bacteria 1194
40 Ga0105246_10000971 3300011119 Bacteria 16425
41 Ga0157370_10001125 3300013104 Bacteria 33417
42 Ga0157374_10004027 3300013296 Bacteria 12349
43 Ga0157378_10089621 3300013297 Bacteria 2794
44 Ga0157375_10035722 3300013308 Bacteria 4747
45 Ga0157376_10027619 3300014969 Bacteria 4501
46 Ga0209564_1004667 3300025295 Bacteria 8224
47 Ga0209758_1000024 3300025297 Bacteria 591966
48 Ga0209758_1000131 3300025297 Bacteria 184259
49 Ga0209758_1019908 3300025297 Bacteria 3207
50 Ga0209758_1020060 3300025297 Bacteria 3184
51 Ga0209256_1001434 3300025299 Bacteria 24692
52 Ga0207426_1002147 3300025302 Bacteria 13450
53 Ga0207426_1004044 3300025302 Bacteria 7423
54 Ga0207426_1058090 3300025302 Bacteria 1123
55 Ga0209257_1001033 3300025304 Bacteria 37252
56 Ga0207680_10092747 3300025903 Bacteria 1925
57 Ga0207647_10069149 3300025904 Bacteria 2135
58 Ga0207647_10109135 3300025904 Bacteria 1637
59 Ga0207705_10006513 3300025909 Bacteria 8652
60 Ga0207695_10152075 3300025913 Bacteria 2253
61 Ga0207663_10025661 3300025916 Bacteria 3410
62 Ga0207649_10027204 3300025920 Bacteria 3354
63 Ga0207679_10289348 3300025945 Bacteria 1408
64 Ga0207639_10077115 3300026041 Bacteria 2626
65 Ga0207678_10016183 3300026067 Bacteria 6548
66 Ga0207698_10008980 3300026142 Bacteria 6344
67 Ga0268265_10074617 3300028380 Bacteria 2654
68 Ga0307517_10000042 3300028786 Bacteria 166943
69 Ga0307509_10056303 3300031507 Bacteria 4174
70 Ga0307510_10002057 3300033180 Bacteria 22728
71 Ga0373943_0196093 3300035170 Bacteria 1116
72 Ga0373931_0047121 3300035691 Bacteria 2281
73 Ga0373927_0007287 3300035695 Bacteria 7502
74 Ga0373933_0268749 3300035724 Bacteria 1100
75 Ga0373947_0037464 3300035725 Bacteria 2878
76 Ga0395900_0183461 3300037418 Bacteria 2125
77 Ga0395905_0000838 3300037471 Bacteria 40172
78 Ga0395905_0505128 3300037471 Bacteria 1109
79 Ga0395901_0161764 3300038443 Bacteria 2351
80 Ga0466965_0219460 3300044683 Bacteria 1013
81 Ga0466963_0012339 3300044694 Bacteria 5227
82 Ga0466957_0147614 3300044842 Bacteria 1519
83 Ga0466967_0056918 3300045976 Bacteria 3449
84 Ga0495651_0024531 3300046462 Bacteria 4691
85 Ga0495606_0020924 3300046507 Bacteria 4805
86 Ga0495606_0111300 3300046507 Bacteria 1651
87 Ga0495628_0479817 3300046516 Bacteria 900
88 Ga0495648_0056421 3300046524 Bacteria 2363
89 Ga0495652_0042818 3300046529 Bacteria 3903
90 Ga0495667_0132160 3300046559 Bacteria 1610
91 Ga0495625_0233987 3300046660 Bacteria 1199
92 Ga0495635_0004801 3300046663 Bacteria 9397
93 Ga0495588_0103497 3300046674 Bacteria 1497
94 Ga0495657_0023738 3300046675 Bacteria 4379
95 Ga0495613_0037296 3300046689 Bacteria 3604
96 Ga0495600_0021522 3300046809 Bacteria 4131
97 Ga0495604_0006641 3300047317 Bacteria 9168
98 Ga0495604_0030464 3300047317 Bacteria 4285
99 Ga0495683_0043782 3300047323 Bacteria 2253
100 Ga0495673_0103841 3300047469 Bacteria 1145
101 Ga0495686_0080930 3300047472 Bacteria 1984
102 Ga0495602_0204023 3300048088 Bacteria 1506
103 Ga0496102_0049223 3300048905 Bacteria 3834
104 Ga0496104_0007828 3300048907 Bacteria 9470
105 Ga0496104_0056659 3300048907 Bacteria 3707
106 Ga0496105_0002112 3300048908 Bacteria 14386
107 Ga0496106_0084635 3300048909 Bacteria 2440
108 Ga0496107_0114275 3300048910 Bacteria 1986
109 Ga0496112_0049898 3300048915 Bacteria 4102
110 Ga0496112_0133996 3300048915 Bacteria 2448
111 Ga0496113_0125569 3300048916 Bacteria 2009
112 Ga0496115_0057375 3300048918 Bacteria 3132
113 Ga0496115_0066142 3300048918 Bacteria 2921
114 Ga0496118_0204079 3300048921 Bacteria 1167
115 Ga0496119_0080806 3300048922 Bacteria 1874
116 Ga0496120_0008150 3300048923 Bacteria 7684
117 Ga0496123_0064162 3300048926 Bacteria 2342
118 Ga0496125_0075244 3300048928 Bacteria 2614
119 Ga0496126_0027536 3300048929 Bacteria 5427
120 Ga0496126_0119951 3300048929 Bacteria 2282
121 Ga0495682_0077945 3300049460 Bacteria 1192
122 nmdc:mga0yw44_194743_c1 3300050492 Bacteria 1337
123 nmdc:mga0yw44_7047_c1 3300050492 Bacteria 5501
124 Ga0495601_0079494 3300053077 Bacteria 2103
125 Ga0495655_0003052 3300053083 Bacteria 2720
126 Ga0500578_0106582 3300053086 Bacteria 1770
127 Ga0500595_004347 3300053119 Bacteria 6376
128 Ga0500559_0033640 3300053136 Bacteria 2207
129 Ga0500601_000061 3300053737 Bacteria 22373
130 Ga0500661_029928 3300055283 Bacteria 961
131 2507508095 2507262055 Bacteria 8048963
132 2513706281 2513237102 Bacteria 7703324
133 2524437196 2524023205 Bacteria 8918781
134 2745076415 2744054633 Bacteria 8678936
135 2793060739 2791355196 Bacteria 7323613
136 2842039435 2842038055 Bacteria 8002051
137 2842047619 2842045827 Bacteria 8006841
138 2844318716 2844315083 Bacteria 8138177
139 2849078761 2849076700 Bacteria 7039503
140 2857515118 2857509624 Bacteria 7472071
141 2881370493 2881364244 Bacteria 7710352
142 2885367961 2885366525 Bacteria 8326213
143 2885382603 2885374607 Bacteria 8927485
144 2888384912 2888378607 Bacteria 9652610
145 2906604455 2906602504 Bacteria 8295279
146 2929616920 2929615660 Bacteria 9193770
147 2929625663 2929624759 Bacteria 9339455
148 2933577798 2933577622 Bacteria 9116884
149 2935679513 2935675223 Bacteria 9928132
150 2935701882 2935694250 Bacteria 9291695
151 2941537661 2941531003 Bacteria 7653939
152 3005508121 3005506211 Bacteria 6943378
153 3005596755 3005594810 Bacteria 8716512
154 8019620062 8019619141 Bacteria 9218857
155 8055748566 8055742211 Bacteria 9226248
156 JGI25160J50197_1016832
157 JGI25153J46596_10000180
158 JGI25153J46596_10000200
159 JGI25153J46596_10000390
160 rootH2_10054602
161 rootH1_10083695
162 Ga0055543_1006347
163 Ga0065165_1002403
164 Ga0065165_1003135
165 Ga0070658_10153738
166 Ga0070682_100083824
167 Ga0070682_100324717
168 Ga0070660_100229616
169 Ga0070661_100375694
170 Ga0070696_100330955
171 Ga0070665_100014794
172 Ga0070665_100091037
173 Ga0070664_100103517
174 Ga0068856_100054526
175 Ga0068852_100030149
176 Ga0081455_10000855
177 Ga0081538_10003419
178 Ga0081538_10097547
179 Ga0075365_10034187
180 Ga0075365_10137225
181 Ga0070715_10012270
182 Ga0070712_100240332
183 Ga0105240_10020239
184 Ga0105247_10003634
185 Ga0105243_10339594
186 Ga0105241_10008542
187 Ga0105248_10025048
188 Ga0105237_10037228
189 Ga0105237_10214507
190 Ga0105238_10264417
191 Ga0105238_10323367
192 Ga0105239_10012754
193 Ga0105239_10370195
194 Ga0105239_10661130
195 Ga0105246_10000971
196 Ga0157370_10001125
197 Ga0157374_10004027
198 Ga0157378_10089621
199 Ga0157375_10035722
200 Ga0157376_10027619
201 Ga0209564_1004667
202 Ga0209758_1000024
203 Ga0209758_1000131
204 Ga0209758_1019908
205 Ga0209758_1020060
206 Ga0209256_1001434
207 Ga0207426_1002147
208 Ga0207426_1004044
209 Ga0207426_1058090
210 Ga0209257_1001033
211 Ga0207680_10092747
212 Ga0207647_10069149
213 Ga0207647_10109135
214 Ga0207705_10006513
215 Ga0207695_10152075
216 Ga0207663_10025661
217 Ga0207649_10027204
218 Ga0207679_10289348
219 Ga0207639_10077115
220 Ga0207678_10016183
221 Ga0207698_10008980
222 Ga0268265_10074617
223 Ga0307517_10000042
224 Ga0307509_10056303
225 Ga0307510_10002057
226 Ga0373943_0196093
227 Ga0373931_0047121
228 Ga0373927_0007287
229 Ga0373933_0268749
230 Ga0373947_0037464
231 Ga0395900_0183461
232 Ga0395905_0000838
233 Ga0395905_0505128
234 Ga0395901_0161764
235 Ga0466965_0219460
236 Ga0466963_0012339
237 Ga0466957_0147614
238 Ga0466967_0056918
239 Ga0495651_0024531
240 Ga0495606_0020924
241 Ga0495606_0111300
242 Ga0495628_0479817
243 Ga0495648_0056421
244 Ga0495652_0042818
245 Ga0495667_0132160
246 Ga0495625_0233987
247 Ga0495635_0004801
248 Ga0495588_0103497
249 Ga0495657_0023738
250 Ga0495613_0037296
251 Ga0495600_0021522
252 Ga0495604_0006641
253 Ga0495604_0030464
254 Ga0495683_0043782
255 Ga0495673_0103841
256 Ga0495686_0080930
257 Ga0495602_0204023
258 Ga0496102_0049223
259 Ga0496104_0007828
260 Ga0496104_0056659
261 Ga0496105_0002112
262 Ga0496106_0084635
263 Ga0496107_0114275
264 Ga0496112_0049898
265 Ga0496112_0133996
266 Ga0496113_0125569
267 Ga0496115_0057375
268 Ga0496115_0066142
269 Ga0496118_0204079
270 Ga0496119_0080806
271 Ga0496120_0008150
272 Ga0496123_0064162
273 Ga0496125_0075244
274 Ga0496126_0027536
275 Ga0496126_0119951
276 Ga0495682_0077945
277 nmdc:mga0yw44_194743_c1
278 nmdc:mga0yw44_7047_c1
279 Ga0495601_0079494
280 Ga0495655_0003052
281 Ga0500578_0106582
282 Ga0500595_004347
283 Ga0500559_0033640
284 Ga0500601_000061
285 Ga0500661_029928
286 2507508095
287 2513706281
288 2524437196
289 2745076415
290 2793060739
291 2842039435
292 2842047619
293 2844318716
294 2849078761
295 2857515118
296 2881370493
297 2885367961
298 2885382603
299 2888384912
300 2906604455
301 2929616920
302 2929625663
303 2933577798
304 2935679513
305 2935701882
306 2941537661
307 3005508121
308 3005596755
309 8019620062
310 8055748566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

69

304

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8etx-assembly1.cif.gz_A ancestral petase 55_547 0.7796 31 291
8eu0-assembly2.cif.gz_B ancestral petase 35_442 mutant e27q 0.7691 31 291
7w66-assembly1.cif.gz_A crystal structure of a psh1 mutant in complex with ligand 0.7528 31 286
2e3j-assembly1.cif.gz_A the crystal structure of epoxide hydrolase b (rv1938) from mycobacterium tuberculosis at 2.1 angstrom 0.7476 35 198
7ym9-assembly2.cif.gz_B crystal structure of a pet hydrolase from cryptosporangium aurantiacum 0.742 31 290
ID Description Score Start End Superfamily
af_A0A0R0GHC4_35_277_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7643 225 293 3.40.50.1820
af_Q7T387_10_213_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.752 46 291 3.40.50.1820
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7241 49 264 3.40.50.1820
af_A0A0P0Y160_2_157_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7214 138 292 3.40.50.1820
af_Q9ZT66_55_242_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7183 49 263 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A433BFX9-F1-model_v4 Alpha/beta hydrolase 0.9529 167 291
AF-A0A811A108-F1-model_v4 deleted 0.9514 176 292
AF-A0A502GKA4-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9319 127 295
AF-A0A1I5A3G2-F1-model_v4 Alpha/beta hydrolase family protein 0.9312 127 295 GO:0052689
AF-A0A7Y9RL28-F1-model_v4 BAAT/Acyl-CoA thioester hydrolase C-terminal domain-containing protein 0.9296 203 292

Map