F220753

General Info

Members Datasets Scaffolds Average Seq Length
154 75 154 303

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_113840_c1|nmdc:mga09592_113840_c1_980_1954
Length 324
Sequence LFHNSQGKPLGFYYHGETFMPRKIKIILNPMADMGNAWRVARDLRSITVEHGNVDWSGTVYPGHAIELAKQASEESYDMVIAMGGDGTVHEVMNGIMQAPEHKRPILGVVPVGSGNDFAHGIGASKDSNQALRRALTGETSTVDLGLMTEENGRQEYFDNTLGIGFGAIVTIRSHKLPILRGFLMYLAAVIQTIILDHHPMKMQIETDDQKWEQKVIYLVLCNGPREGGGFLIAPDAKIDDGIIHYAMITDVSRPMMFRIVPEVMKGTHGRFKQVRMGSCKKFTLIADRPLYIHADGEIFSGPGTDIRKVSFEILPNALKVVRG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
38 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
39 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
40 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
41 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
62 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
63 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
64 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
65 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
66 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
69 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
70 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
71 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
72 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
73 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
74 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
75 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3710223 2162886007 Bacteria 7733
2 Ga0065704_10070754 3300005289 Bacteria 16673
3 Ga0065704_10123609 3300005289 Unclassified 1671
4 Ga0065707_10082004 3300005295 Bacteria 25365
5 Ga0065707_10189733 3300005295 Unclassified 1368
6 Ga0065707_10252524 3300005295 Bacteria 1103
7 Ga0070705_100013195 3300005440 Bacteria 4220
8 Ga0070694_100051835 3300005444 Bacteria 2772
9 Ga0070706_100444705 3300005467 Unclassified 1206
10 Ga0070698_100173114 3300005471 Unclassified 2099
11 Ga0070698_100182680 3300005471 Bacteria 2035
12 Ga0070699_100002183 3300005518 Bacteria 17708
13 Ga0070699_100073548 3300005518 Bacteria 2973
14 Ga0070699_100113134 3300005518 Bacteria 2384
15 Ga0070699_100188635 3300005518 Unclassified 1831
16 Ga0070697_100058374 3300005536 Bacteria 3140
17 Ga0070696_100385889 3300005546 Bacteria 1093
18 Ga0070704_100119072 3300005549 Bacteria 2024
19 Ga0070704_100455117 3300005549 Bacteria 1103
20 Ga0068857_100303484 3300005577 Bacteria 1472
21 Ga0068859_100016949 3300005617 Bacteria 7311
22 Ga0068861_100029268 3300005719 Bacteria 4029
23 Ga0068862_100014878 3300005844 Bacteria 6463
24 Ga0068862_100089854 3300005844 Bacteria 2674
25 Ga0081539_10002605 3300005985 Bacteria 24737
26 Ga0081539_10034771 3300005985 Bacteria 3040
27 Ga0075427_10012333 3300006194 Bacteria 1296
28 Ga0075428_100036684 3300006844 Bacteria 5398
29 Ga0075428_100056147 3300006844 Unclassified 4314
30 Ga0075428_100154013 3300006844 Bacteria 2497
31 Ga0075428_100506612 3300006844 Bacteria 1291
32 Ga0075430_100127227 3300006846 Bacteria 2124
33 Ga0075431_100163246 3300006847 Bacteria 2290
34 Ga0075431_100332656 3300006847 Bacteria 1529
35 Ga0075433_10340962 3300006852 Unclassified 1325
36 Ga0075429_100001945 3300006880 Bacteria 17151
37 Ga0075429_100054123 3300006880 Unclassified 3491
38 Ga0075429_100072408 3300006880 Bacteria 3001
39 Ga0075429_100154936 3300006880 Unclassified 2006
40 Ga0075429_100383273 3300006880 Unclassified 1231
41 Ga0097620_100016949 3300006931 Bacteria 7311
42 Ga0111539_10042014 3300009094 Bacteria 5494
43 Ga0114129_10000734 3300009147 Bacteria 41734
44 Ga0114129_10001625 3300009147 Bacteria 30489
45 Ga0114129_10012776 3300009147 Bacteria 11953
46 Ga0114129_10037928 3300009147 Bacteria 6799
47 Ga0114129_10051424 3300009147 Bacteria 5785
48 Ga0114129_10271313 3300009147 Unclassified 2269
49 Ga0114129_10315965 3300009147 Bacteria 2078
50 Ga0114129_10695952 3300009147 Unclassified 1307
51 Ga0105242_10279254 3300009176 Bacteria 1516
52 Ga0105249_10156386 3300009553 Bacteria 2199
53 Ga0105246_10016657 3300011119 Bacteria 4657
54 Ga0157380_10065000 3300014326 Bacteria 2930
55 Ga0207684_10400237 3300025910 Unclassified 1180
56 Ga0207706_10001210 3300025933 Bacteria 26082
57 Ga0207670_10233131 3300025936 Unclassified 1414
58 Ga0207712_10092495 3300025961 Bacteria 2230
59 Ga0207674_10079541 3300026116 Bacteria 3282
60 Ga0207674_10107528 3300026116 Bacteria 2766
61 Ga0207675_100027095 3300026118 Bacteria 5336
62 Ga0207675_100206961 3300026118 Bacteria 1886
63 Ga0268265_10131549 3300028380 Unclassified 2080
64 Ga0265330_10150583 3300031235 Unclassified 988
65 Ga0265332_10104550 3300031238 Unclassified 1194
66 Ga0265325_10118930 3300031241 Unclassified 1276
67 Ga0265340_10000800 3300031247 Bacteria 17839
68 Ga0265331_10007005 3300031250 Bacteria 6579
69 Ga0265316_10046452 3300031344 Unclassified 3440
70 Ga0307408_100248728 3300031548 Bacteria 1465
71 Ga0316579_10021358 3300031691 Bacteria 2884
72 Ga0316579_10152201 3300031691 Unclassified 1116
73 Ga0265342_10172043 3300031712 Unclassified 1191
74 Ga0316576_10128490 3300031727 Bacteria 1906
75 Ga0316578_10122110 3300031728 Bacteria 1566
76 Ga0307413_10152409 3300031824 Bacteria 1613
77 Ga0307410_10073631 3300031852 Bacteria 2376
78 Ga0307407_10007828 3300031903 Bacteria 4864
79 Ga0307416_100221314 3300032002 Bacteria 1816
80 Ga0316574_0022358 3300035398 Unclassified 3763
81 Ga0316574_0062266 3300035398 Bacteria 2345
82 Ga0373937_0143682 3300036401 Bacteria 2233
83 Ga0316582_0025218 3300036647 Unclassified 3568
84 Ga0316582_0081847 3300036647 Bacteria 2110
85 Ga0316584_0057089 3300036712 Unclassified 2922
86 Ga0316584_0173877 3300036712 Bacteria 1596
87 Ga0316581_0012190 3300037588 Unclassified 2417
88 Ga0451577_0000590 3300042876 Bacteria 58228
89 Ga0451577_0019101 3300042876 Bacteria 6305
90 Ga0451577_0027810 3300042876 Bacteria 5118
91 Ga0451577_0063669 3300042876 Bacteria 3289
92 Ga0451577_0084791 3300042876 Bacteria 2827
93 Ga0451577_0151093 3300042876 Unclassified 2089
94 Ga0451577_0324994 3300042876 Bacteria 1395
95 Ga0451577_0348393 3300042876 Unclassified 1343
96 Ga0453683_0000709 3300044673 Bacteria 34522
97 Ga0453683_0020527 3300044673 Bacteria 4221
98 Ga0453683_0044804 3300044673 Bacteria 2774
99 Ga0453683_0069107 3300044673 Bacteria 2208
100 Ga0453683_0088143 3300044673 Bacteria 1945
101 Ga0453683_0191054 3300044673 Unclassified 1299
102 Ga0453684_0000003 3300044712 Bacteria 1481694
103 Ga0453684_0000023 3300044712 Bacteria 857153
104 Ga0453684_0000157 3300044712 Bacteria 304259
105 Ga0453684_0001179 3300044712 Bacteria 81099
106 Ga0453684_0002638 3300044712 Bacteria 42867
107 Ga0453684_0004916 3300044712 Bacteria 27306
108 Ga0453684_0007114 3300044712 Bacteria 20856
109 Ga0453684_0010441 3300044712 Bacteria 15884
110 Ga0453684_0036373 3300044712 Bacteria 6786
111 Ga0453684_0057570 3300044712 Bacteria 5029
112 Ga0453684_0058127 3300044712 Bacteria 4997
113 Ga0453684_0058680 3300044712 Bacteria 4969
114 Ga0453684_0069412 3300044712 Bacteria 4470
115 Ga0453684_0119207 3300044712 Bacteria 3190
116 Ga0453684_0151329 3300044712 Bacteria 2757
117 Ga0453684_0169351 3300044712 Bacteria 2576
118 Ga0453684_0199576 3300044712 Bacteria 2333
119 Ga0453684_0227259 3300044712 Bacteria 2157
120 Ga0453684_0241442 3300044712 Bacteria 2079
121 Ga0453684_0242428 3300044712 Bacteria 2074
122 Ga0453684_0313496 3300044712 Bacteria 1779
123 Ga0453684_0332441 3300044712 Bacteria 1718
124 Ga0453684_0647687 3300044712 Unclassified 1153
125 Ga0451576_0000311 3300045051 Bacteria 117825
126 Ga0451576_0002918 3300045051 Bacteria 24343
127 Ga0451576_0013327 3300045051 Bacteria 9198
128 Ga0451576_0025640 3300045051 Bacteria 6351
129 Ga0451576_0130361 3300045051 Bacteria 2621
130 Ga0451576_0171939 3300045051 Unclassified 2261
131 Ga0451576_0381642 3300045051 Unclassified 1477
132 Ga0501298_009314 3300049521 Bacteria 1668
133 Ga0501299_029119 3300049522 Bacteria 1056
134 Ga0501072_0290563 3300049588 Bacteria 1300
135 Ga0501076_0243239 3300049592 Bacteria 1472
136 Ga0501227_032334 3300049665 Unclassified 1262
137 Ga0501079_0033599 3300049741 Bacteria 3946
138 Ga0501080_0450372 3300049742 Unclassified 1154
139 Ga0501081_0111311 3300049743 Bacteria 1943
140 nmdc:mga05p37_167860_c1 3300050507 Unclassified 2678
141 nmdc:mga05p37_183360_c1 3300050507 Bacteria 2546
142 nmdc:mga05p37_340386_c1 3300050507 Bacteria 1769
143 nmdc:mga05p37_358691_c1 3300050507 Bacteria 1714
144 nmdc:mga09592_102046_c1 3300050508 Bacteria 2458
145 nmdc:mga09592_113840_c1 3300050508 Unclassified 2322
146 nmdc:mga09592_310425_c1 3300050508 Unclassified 1367
147 nmdc:mga09592_4201_c1 3300050508 Bacteria 11637
148 nmdc:mga09592_493_c1 3300050508 Bacteria 29628
149 nmdc:mga0qj67_126285_c1 3300050509 Unclassified 2070
150 nmdc:mga0qj67_159314_c1 3300050509 Bacteria 1832
151 nmdc:mga06r32_226732_c1 3300050510 Bacteria 1857
152 nmdc:mga0a205_313494_c1 3300050515 Bacteria 1440
153 Ga0501084_0136645 3300054114 Bacteria 2064
154 Ga0530510_0098419 3300061734 Bacteria 2139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0290563 Ga0501072_0290563_398_1282 272
2 3300025933 Ga0207706_10001210 Ga0207706_1000121022 276
3 3300005467 Ga0070706_100444705 Ga0070706_1004447051 279
4 3300025910 Ga0207684_10400237 Ga0207684_104002372 279
5 3300005440 Ga0070705_100013195 Ga0070705_1000131952 280
6 3300005444 Ga0070694_100051835 Ga0070694_1000518352 280
7 3300005471 Ga0070698_100182680 Ga0070698_1001826802 280
8 3300005536 Ga0070697_100058374 Ga0070697_1000583742 280
9 3300005546 Ga0070696_100385889 Ga0070696_1003858891 280
10 3300009176 Ga0105242_10279254 Ga0105242_102792542 280
11 3300026118 Ga0207675_100206961 Ga0207675_1002069612 280
12 3300037588 Ga0316581_0012190 Ga0316581_0012190_1550_2407 285
13 3300031691 Ga0316579_10021358 Ga0316579_100213581 294
14 3300036647 Ga0316582_0025218 Ga0316582_0025218_948_1832 294
15 3300036712 Ga0316584_0057089 Ga0316584_0057089_545_1429 294
16 3300044712 Ga0453684_0000157 Ga0453684_0000157_34183_35073 294
17 3300044712 Ga0453684_0151329 Ga0453684_0151329_1673_2563 294
18 3300044712 Ga0453684_0332441 Ga0453684_0332441_204_1094 294
19 3300049522 Ga0501299_029119 Ga0501299_029119_22_906 294
20 3300049592 Ga0501076_0243239 Ga0501076_0243239_322_1206 294
21 3300049741 Ga0501079_0033599 Ga0501079_0033599_238_1122 294
22 3300049743 Ga0501081_0111311 Ga0501081_0111311_66_950 294
23 3300054114 Ga0501084_0136645 Ga0501084_0136645_1132_2016 294
24 3300061734 Ga0530510_0098419 Ga0530510_0098419_1127_2011 294
25 3300009147 Ga0114129_10315965 Ga0114129_103159652 295
26 3300044712 Ga0453684_0069412 Ga0453684_0069412_2440_3357 295
27 3300050507 nmdc:mga05p37_358691_c1 nmdc:mga05p37_358691_c1_249_1166 295
28 3300009147 Ga0114129_10695952 Ga0114129_106959522 298
29 3300036401 Ga0373937_0143682 Ga0373937_0143682_159_1076 303
30 3300042876 Ga0451577_0151093 Ga0451577_0151093_289_1200 303
31 3300044712 Ga0453684_0058127 Ga0453684_0058127_1427_2338 303
32 3300044712 Ga0453684_0242428 Ga0453684_0242428_917_1828 303
33 3300036647 Ga0316582_0081847 Ga0316582_0081847_991_1908 304
34 3300036712 Ga0316584_0173877 Ga0316584_0173877_28_945 304
35 2162886007 SwRhRL2b_contig_3710223 SwRhRL2b_0459.00000480 305
36 3300005289 Ga0065704_10070754 Ga0065704_1007075412 305
37 3300005289 Ga0065704_10123609 Ga0065704_101236092 305
38 3300005295 Ga0065707_10082004 Ga0065707_1008200431 305
39 3300005295 Ga0065707_10189733 Ga0065707_101897332 305
40 3300005295 Ga0065707_10252524 Ga0065707_102525241 305
41 3300005471 Ga0070698_100173114 Ga0070698_1001731142 305
42 3300005518 Ga0070699_100002183 Ga0070699_1000021839 305
43 3300005518 Ga0070699_100073548 Ga0070699_1000735482 305
44 3300005518 Ga0070699_100113134 Ga0070699_1001131342 305
45 3300005518 Ga0070699_100188635 Ga0070699_1001886352 305
46 3300005549 Ga0070704_100119072 Ga0070704_1001190722 305
47 3300005549 Ga0070704_100455117 Ga0070704_1004551171 305
48 3300005577 Ga0068857_100303484 Ga0068857_1003034842 305
49 3300005617 Ga0068859_100016949 Ga0068859_1000169494 305
50 3300005719 Ga0068861_100029268 Ga0068861_1000292683 305
51 3300005844 Ga0068862_100014878 Ga0068862_1000148783 305
52 3300005844 Ga0068862_100089854 Ga0068862_1000898542 305
53 3300005985 Ga0081539_10002605 Ga0081539_1000260514 305
54 3300005985 Ga0081539_10034771 Ga0081539_100347712 305
55 3300006194 Ga0075427_10012333 Ga0075427_100123332 305
56 3300006844 Ga0075428_100036684 Ga0075428_1000366841 305
57 3300006844 Ga0075428_100056147 Ga0075428_1000561473 305
58 3300006844 Ga0075428_100154013 Ga0075428_1001540132 305
59 3300006844 Ga0075428_100506612 Ga0075428_1005066122 305
60 3300006846 Ga0075430_100127227 Ga0075430_1001272272 305
61 3300006847 Ga0075431_100163246 Ga0075431_1001632462 305
62 3300006847 Ga0075431_100332656 Ga0075431_1003326562 305
63 3300006852 Ga0075433_10340962 Ga0075433_103409622 305
64 3300006880 Ga0075429_100001945 Ga0075429_10000194510 305
65 3300006880 Ga0075429_100054123 Ga0075429_1000541233 305
66 3300006880 Ga0075429_100072408 Ga0075429_1000724082 305
67 3300006880 Ga0075429_100154936 Ga0075429_1001549362 305
68 3300006880 Ga0075429_100383273 Ga0075429_1003832732 305
69 3300006931 Ga0097620_100016949 Ga0097620_1000169494 305
70 3300009094 Ga0111539_10042014 Ga0111539_100420143 305
71 3300009147 Ga0114129_10000734 Ga0114129_1000073418 305
72 3300009147 Ga0114129_10001625 Ga0114129_100016255 305
73 3300009147 Ga0114129_10012776 Ga0114129_1001277610 305
74 3300009147 Ga0114129_10037928 Ga0114129_100379282 305
75 3300009147 Ga0114129_10051424 Ga0114129_100514242 305
76 3300009147 Ga0114129_10271313 Ga0114129_102713132 305
77 3300009553 Ga0105249_10156386 Ga0105249_101563862 305
78 3300011119 Ga0105246_10016657 Ga0105246_100166572 305
79 3300014326 Ga0157380_10065000 Ga0157380_100650002 305
80 3300025936 Ga0207670_10233131 Ga0207670_102331312 305
81 3300025961 Ga0207712_10092495 Ga0207712_100924952 305
82 3300026116 Ga0207674_10079541 Ga0207674_100795411 305
83 3300026116 Ga0207674_10107528 Ga0207674_101075282 305
84 3300026118 Ga0207675_100027095 Ga0207675_1000270952 305
85 3300028380 Ga0268265_10131549 Ga0268265_101315492 305
86 3300031235 Ga0265330_10150583 Ga0265330_101505831 305
87 3300031238 Ga0265332_10104550 Ga0265332_101045501 305
88 3300031241 Ga0265325_10118930 Ga0265325_101189302 305
89 3300031247 Ga0265340_10000800 Ga0265340_100008002 305
90 3300031250 Ga0265331_10007005 Ga0265331_100070053 305
91 3300031344 Ga0265316_10046452 Ga0265316_100464523 305
92 3300031548 Ga0307408_100248728 Ga0307408_1002487282 305
93 3300031691 Ga0316579_10152201 Ga0316579_101522011 305
94 3300031712 Ga0265342_10172043 Ga0265342_101720431 305
95 3300031727 Ga0316576_10128490 Ga0316576_101284902 305
96 3300031728 Ga0316578_10122110 Ga0316578_101221102 305
97 3300031824 Ga0307413_10152409 Ga0307413_101524092 305
98 3300031852 Ga0307410_10073631 Ga0307410_100736312 305
99 3300031903 Ga0307407_10007828 Ga0307407_100078285 305
100 3300032002 Ga0307416_100221314 Ga0307416_1002213142 305
101 3300035398 Ga0316574_0022358 Ga0316574_0022358_2543_3475 305
102 3300035398 Ga0316574_0062266 Ga0316574_0062266_163_1086 305
103 3300042876 Ga0451577_0000590 Ga0451577_0000590_54065_54988 305
104 3300042876 Ga0451577_0019101 Ga0451577_0019101_438_1394 305
105 3300042876 Ga0451577_0027810 Ga0451577_0027810_3725_4645 305
106 3300042876 Ga0451577_0063669 Ga0451577_0063669_1840_2763 305
107 3300042876 Ga0451577_0084791 Ga0451577_0084791_786_1712 305
108 3300042876 Ga0451577_0324994 Ga0451577_0324994_298_1221 305
109 3300042876 Ga0451577_0348393 Ga0451577_0348393_28_954 305
110 3300044673 Ga0453683_0000709 Ga0453683_0000709_22417_23340 305
111 3300044673 Ga0453683_0020527 Ga0453683_0020527_776_1699 305
112 3300044673 Ga0453683_0044804 Ga0453683_0044804_1755_2678 305
113 3300044673 Ga0453683_0069107 Ga0453683_0069107_333_1256 305
114 3300044673 Ga0453683_0088143 Ga0453683_0088143_479_1405 305
115 3300044673 Ga0453683_0191054 Ga0453683_0191054_140_1060 305
116 3300044712 Ga0453684_0000003 Ga0453684_0000003_98052_98972 305
117 3300044712 Ga0453684_0000023 Ga0453684_0000023_719156_720079 305
118 3300044712 Ga0453684_0001179 Ga0453684_0001179_62918_63841 305
119 3300044712 Ga0453684_0002638 Ga0453684_0002638_9034_9957 305
120 3300044712 Ga0453684_0004916 Ga0453684_0004916_16800_17723 305
121 3300044712 Ga0453684_0007114 Ga0453684_0007114_16689_17612 305
122 3300044712 Ga0453684_0010441 Ga0453684_0010441_13471_14397 305
123 3300044712 Ga0453684_0036373 Ga0453684_0036373_4695_5618 305
124 3300044712 Ga0453684_0057570 Ga0453684_0057570_610_1533 305
125 3300044712 Ga0453684_0058680 Ga0453684_0058680_2607_3557 305
126 3300044712 Ga0453684_0119207 Ga0453684_0119207_2250_3176 305
127 3300044712 Ga0453684_0169351 Ga0453684_0169351_1334_2251 305
128 3300044712 Ga0453684_0199576 Ga0453684_0199576_1377_2300 305
129 3300044712 Ga0453684_0227259 Ga0453684_0227259_1163_2113 305
130 3300044712 Ga0453684_0241442 Ga0453684_0241442_1115_2059 305
131 3300044712 Ga0453684_0313496 Ga0453684_0313496_356_1279 305
132 3300044712 Ga0453684_0647687 Ga0453684_0647687_68_994 305
133 3300045051 Ga0451576_0000311 Ga0451576_0000311_89734_90663 305
134 3300045051 Ga0451576_0002918 Ga0451576_0002918_12673_13596 305
135 3300045051 Ga0451576_0013327 Ga0451576_0013327_794_1717 305
136 3300045051 Ga0451576_0025640 Ga0451576_0025640_446_1366 305
137 3300045051 Ga0451576_0130361 Ga0451576_0130361_177_1100 305
138 3300045051 Ga0451576_0171939 Ga0451576_0171939_367_1290 305
139 3300045051 Ga0451576_0381642 Ga0451576_0381642_313_1230 305
140 3300049521 Ga0501298_009314 Ga0501298_009314_81_1004 305
141 3300049665 Ga0501227_032334 Ga0501227_032334_251_1168 305
142 3300049742 Ga0501080_0450372 Ga0501080_0450372_73_990 305
143 3300050507 nmdc:mga05p37_167860_c1 nmdc:mga05p37_167860_c1_881_1798 305
144 3300050507 nmdc:mga05p37_183360_c1 nmdc:mga05p37_183360_c1_91_1008 305
145 3300050507 nmdc:mga05p37_340386_c1 nmdc:mga05p37_340386_c1_152_1069 305
146 3300050508 nmdc:mga09592_102046_c1 nmdc:mga09592_102046_c1_655_1572 305
147 3300050508 nmdc:mga09592_113840_c1 nmdc:mga09592_113840_c1_980_1954 305
148 3300050508 nmdc:mga09592_310425_c1 nmdc:mga09592_310425_c1_351_1268 305
149 3300050508 nmdc:mga09592_4201_c1 nmdc:mga09592_4201_c1_9116_10033 305
150 3300050508 nmdc:mga09592_493_c1 nmdc:mga09592_493_c1_10499_11416 305
151 3300050509 nmdc:mga0qj67_126285_c1 nmdc:mga0qj67_126285_c1_129_1046 305
152 3300050509 nmdc:mga0qj67_159314_c1 nmdc:mga0qj67_159314_c1_144_1061 305
153 3300050510 nmdc:mga06r32_226732_c1 nmdc:mga06r32_226732_c1_492_1466 305
154 3300050515 nmdc:mga0a205_313494_c1 nmdc:mga0a205_313494_c1_122_1039 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

23

148

0.97

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

160

323

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qvl-assembly1.cif.gz_A crystal structure of diacylglycerol kinase 0.888 1 305
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8874 3 305
4wer-assembly1.cif.gz_A-2 crystal structure of diacylglycerol kinase catalytic domain protein from enterococcus faecalis v583 0.8662 1 305
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8585 3 305
4wer-assembly1.cif.gz_A-2 crystal structure of diacylglycerol kinase catalytic domain protein from enterococcus faecalis v583 0.8577 1 305
ID Description Score Start End Superfamily
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9134 5 120 3.40.50.10330
2qvlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9031 2 122 3.40.50.10330
3t5pC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9008 3 124 3.40.50.10330
af_P9WP29_9_143_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8965 2 135 3.40.50.10330
af_A0A1D6EY64_251_476_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8894 136 282 2.60.200.40
ID Description Score Start End GO Terms
AF-A0A3B9J6X5-F1-model_v4 Diacylglycerol kinase 0.9652 1 112 GO:0004143
GO:0005886
AF-A0A517U1X7-F1-model_v4 Diacylglycerol kinase (EC 2.7.1.107) 0.9612 3 305 GO:0004143
GO:0005524
GO:0005886
GO:0008654
AF-A0A524L8N9-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9605 3 305 GO:0004143
GO:0005524
GO:0005886
GO:0008654
GO:0046872
AF-A0A7C1P2Z3-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9576 5 303 GO:0004143
GO:0005524
GO:0005886
GO:0008654
GO:0046872
AF-A0A3B0UPQ8-F1-model_v4 Transcription regulator [contains diacylglycerol kinase catalytic domain] 0.9563 87 303 GO:0004143
GO:0005524
GO:0005886

Feature Viewer

pLDDT pTM Quality
91.31 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map