F220185

General Info

Members Datasets Scaffolds Average Seq Length
154 122 148 174

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0326358|Ga0436364_0326358_589_1179
Length 196
Sequence MSSDFSIQLGLAHLQLLKGDITRIKVDAIVNAANSALAGGGGVDGAIHRAGGPEIMRELDAIRERDGGCATGNAVVTGAGLLPAKYVLHAVGPRYRDGSHGERELLTSCYIVCLQLAAERDVKTISFPSISTGIYGYPIEQAAEIAVRTTAGWLREHRGPVHTVKLVQFSDADHEVYRRHAQSLRGTLAAGITAKM

Samples

Sample ID Description Type Environment
1 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
2 2904456579 Variovorax sp. 2002 Isolate Unclassified
3 2914759650 Rhizosphaericola mali Isolate Rhizosphere
4 2929520902 Variovorax beijingensis 502 Isolate Unclassified
5 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
6 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
108 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
109 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
110 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
111 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
112 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
113 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
121 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0.65
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.78
Nodule 0
Rhizoplane 0.65
Rhizosphere 73.38
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1005497 3300002773 Bacteria 3674
2 JGI25406J46586_10004645 3300003203 Bacteria 6393
3 JGI25153J46596_10000405 3300003215 Bacteria 28717
4 Ga0055535_1000047 3300003761 Bacteria 139836
5 Ga0055529_1000148 3300003763 Bacteria 100809
6 Ga0055526_1004403 3300003771 Bacteria 8477
7 Ga0055530_10005848 3300003791 Bacteria 5697
8 Ga0055540_1011028 3300003792 Bacteria 2952
9 Ga0065165_1005989 3300005262 Bacteria 6560
10 Ga0070658_10099455 3300005327 Bacteria 2403
11 Ga0070658_10107958 3300005327 Bacteria 2303
12 Ga0070658_10177398 3300005327 Bacteria 1792
13 Ga0070683_100808405 3300005329 Bacteria 899
14 Ga0070670_100076409 3300005331 Bacteria 2877
15 Ga0070680_100852624 3300005336 Bacteria 785
16 Ga0070660_100995750 3300005339 Bacteria 708
17 Ga0070661_100676938 3300005344 Bacteria 839
18 Ga0070713_100008578 3300005436 Bacteria 7257
19 Ga0070711_100104903 3300005439 Bacteria 2063
20 Ga0070700_100016953 3300005441 Bacteria 4158
21 Ga0070694_100176534 3300005444 Bacteria 1577
22 Ga0070665_100767048 3300005548 Bacteria 977
23 Ga0070704_100310574 3300005549 Bacteria 1317
24 Ga0070664_100065301 3300005564 Bacteria 3105
25 Ga0068861_100000529 3300005719 Bacteria 22393
26 Ga0081538_10004614 3300005981 Bacteria 12655
27 Ga0081538_10018570 3300005981 Bacteria 5214
28 Ga0081538_10038037 3300005981 Bacteria 3111
29 Ga0081539_10010991 3300005985 Bacteria 7249
30 Ga0070717_10014295 3300006028 Bacteria 6105
31 Ga0075365_10124572 3300006038 Bacteria 1780
32 Ga0075366_10143324 3300006195 Bacteria 1445
33 Ga0075366_10656392 3300006195 Bacteria 651
34 Ga0097621_101336028 3300006237 Bacteria 678
35 Ga0075370_10057508 3300006353 Bacteria 2210
36 Ga0075370_10158284 3300006353 Bacteria 1328
37 Ga0105240_10714507 3300009093 Bacteria 1093
38 Ga0111539_10783213 3300009094 Bacteria 1110
39 Ga0105248_11701686 3300009177 Bacteria 715
40 Ga0105237_10036649 3300009545 Bacteria 4963
41 Ga0157371_10188709 3300013102 Bacteria 1475
42 Ga0157370_10402254 3300013104 Unclassified 1260
43 Ga0157378_10484701 3300013297 Bacteria 1233
44 Ga0163163_10000557 3300014325 Bacteria 32741
45 Ga0157380_10026466 3300014326 Bacteria 4404
46 Ga0182008_10027811 3300014497 Bacteria 2862
47 Ga0182008_10323837 3300014497 Bacteria 812
48 Ga0182008_10531569 3300014497 Bacteria 651
49 Ga0209258_100072 3300025242 Bacteria 274355
50 Ga0207425_1001619 3300025245 Bacteria 9083
51 Ga0209148_1028298 3300025254 Bacteria 854
52 Ga0209759_1001038 3300025256 Bacteria 18597
53 Ga0209129_1000012 3300025258 Bacteria 541516
54 Ga0209455_1000053 3300025272 Bacteria 365949
55 Ga0209673_1007121 3300025273 Bacteria 5236
56 Ga0209673_1013690 3300025273 Bacteria 3188
57 Ga0209676_1017218 3300025292 Bacteria 2569
58 Ga0209564_1000022 3300025295 Bacteria 555109
59 Ga0209758_1000659 3300025297 Bacteria 51717
60 Ga0209050_1000165 3300025298 Bacteria 152109
61 Ga0209256_1046335 3300025299 Bacteria 1075
62 Ga0209051_1000159 3300025303 Bacteria 126836
63 Ga0209051_1049632 3300025303 Bacteria 1412
64 Ga0207642_10282722 3300025899 Bacteria 955
65 Ga0207699_10031584 3300025906 Bacteria 2975
66 Ga0207705_10136487 3300025909 Bacteria 1829
67 Ga0207705_10158443 3300025909 Bacteria 1699
68 Ga0207705_10202313 3300025909 Unclassified 1505
69 Ga0207663_10029401 3300025916 Bacteria 3227
70 Ga0207657_10840700 3300025919 Bacteria 709
71 Ga0207694_10082468 3300025924 Bacteria 2528
72 Ga0207650_10003727 3300025925 Bacteria 10424
73 Ga0207700_10003071 3300025928 Bacteria 9643
74 Ga0207700_10338613 3300025928 Bacteria 1307
75 Ga0207664_10003703 3300025929 Bacteria 10249
76 Ga0207669_10775008 3300025937 Bacteria 794
77 Ga0207665_10460488 3300025939 Bacteria 977
78 Ga0207661_10649152 3300025944 Bacteria 970
79 Ga0207679_10027658 3300025945 Bacteria 3925
80 Ga0207712_10837006 3300025961 Bacteria 810
81 Ga0207675_100002445 3300026118 Bacteria 18394
82 Ga0207683_10261049 3300026121 Bacteria 1582
83 Ga0207698_10008912 3300026142 Bacteria 6361
84 Ga0207698_10720614 3300026142 Bacteria 994
85 Ga0307517_10127838 3300028786 Bacteria 1845
86 Ga0316176_1157635 3300030732 Bacteria 719
87 Ga0265316_10087615 3300031344 Bacteria 2378
88 Ga0307408_100110361 3300031548 Bacteria 2112
89 Ga0307514_10004934 3300031649 Bacteria 12118
90 Ga0307405_10532953 3300031731 Bacteria 947
91 Ga0307405_10973530 3300031731 Bacteria 722
92 Ga0307405_11036713 3300031731 Bacteria 702
93 Ga0307413_10294033 3300031824 Bacteria 1228
94 Ga0307413_10700633 3300031824 Bacteria 841
95 Ga0307406_10011859 3300031901 Bacteria 4953
96 Ga0307407_10056401 3300031903 Bacteria 2274
97 Ga0307412_10103829 3300031911 Bacteria 2015
98 Ga0307412_10544712 3300031911 Bacteria 974
99 Ga0307409_100014814 3300031995 Bacteria 5088
100 Ga0307409_100494681 3300031995 Bacteria 1189
101 Ga0307409_100613663 3300031995 Bacteria 1077
102 Ga0307409_100688318 3300031995 Bacteria 1020
103 Ga0307409_101148454 3300031995 Bacteria 799
104 Ga0307416_100045222 3300032002 Bacteria 3465
105 Ga0307416_100141037 3300032002 Bacteria 2190
106 Ga0307416_100435685 3300032002 Bacteria 1359
107 Ga0307416_101042306 3300032002 Bacteria 922
108 Ga0307414_10032077 3300032004 Bacteria 3455
109 Ga0307414_10156718 3300032004 Bacteria 1804
110 Ga0307411_10029624 3300032005 Bacteria 3346
111 Ga0307411_11128591 3300032005 Bacteria 708
112 Ga0307415_100048651 3300032126 Bacteria 2862
113 Ga0307415_100159042 3300032126 Bacteria 1749
114 Ga0307415_100176768 3300032126 Bacteria 1671
115 Ga0307415_101031000 3300032126 Bacteria 766
116 Ga0316593_10046064 3300032168 Bacteria 1463
117 Ga0373947_0070733 3300035725 Unclassified 2139
118 Ga0373947_0278692 3300035725 Bacteria 1111
119 Ga0373937_0415303 3300036401 Bacteria 1277
120 Ga0395900_0206765 3300037418 Bacteria 1984
121 Ga0436364_0326358 3300037853 Bacteria 1310
122 Ga0451855_0510058 3300041511 Bacteria 844
123 Ga0451853_1982668 3300041512 Bacteria 2186
124 Ga0451577_0031154 3300042876 Bacteria 4814
125 Ga0495580_0075406 3300046472 Bacteria 2353
126 Ga0495628_0179745 3300046516 Bacteria 1601
127 Ga0495630_0383655 3300046517 Unclassified 1076
128 Ga0495667_0109052 3300046559 Bacteria 1789
129 Ga0495674_0491587 3300047319 Unclassified 982
130 Ga0495674_0561023 3300047319 Bacteria 908
131 Ga0495684_0592544 3300047471 Unclassified 749
132 Ga0496112_0349230 3300048915 Bacteria 1422
133 Ga0501298_044591 3300049521 Bacteria 906
134 Ga0501216_054548 3300049660 Bacteria 793
135 Ga0501243_015594 3300049675 Bacteria 1223
136 Ga0501234_020450 3300049707 Bacteria 1053
137 Ga0501271_003119 3300049768 Bacteria 1518
138 Ga0501273_058181 3300049770 Bacteria 604
139 Ga0501212_007523 3300049851 Bacteria 1495
140 nmdc:mga0k408_131582_c1 3300050493 Bacteria 1485
141 nmdc:mga07m45_124392_c1 3300050496 Bacteria 1491
142 nmdc:mga0rr50_448822_c1 3300050513 Bacteria 1093
143 Ga0500578_0000007 3300053086 Bacteria 229642
144 Ga0500644_0105772 3300053088 Bacteria 1076
145 Ga0500604_0076055 3300053151 Bacteria 1078
146 Ga0590071_042575 3300059421 Bacteria 1094
147 Ga0590074_019448 3300059423 Bacteria 1165
148 Ga0590075_001149 3300059424 Bacteria 6723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10531569 Ga0182008_105315692 140
2 3300025899 Ga0207642_10282722 Ga0207642_102827222 148
3 3300005548 Ga0070665_100767048 Ga0070665_1007670482 150
4 3300006237 Ga0097621_101336028 Ga0097621_1013360281 152
5 3300026142 Ga0207698_10720614 Ga0207698_107206142 152
6 3300049675 Ga0501243_015594 Ga0501243_015594_532_1023 159
7 3300049707 Ga0501234_020450 Ga0501234_020450_262_753 159
8 3300049768 Ga0501271_003119 Ga0501271_003119_88_579 159
9 3300049770 Ga0501273_058181 Ga0501273_058181_61_552 159
10 3300049851 Ga0501212_007523 Ga0501212_007523_987_1478 159
11 3300032168 Ga0316593_10046064 Ga0316593_100460642 162
12 3300005327 Ga0070658_10099455 Ga0070658_100994553 163
13 3300025909 Ga0207705_10136487 Ga0207705_101364873 163
14 3300050513 nmdc:mga0rr50_448822_c1 nmdc:mga0rr50_448822_c1_248_748 163
15 3300005327 Ga0070658_10107958 Ga0070658_101079583 164
16 3300005339 Ga0070660_100995750 Ga0070660_1009957501 164
17 3300006038 Ga0075365_10124572 Ga0075365_101245722 164
18 3300025909 Ga0207705_10158443 Ga0207705_101584433 164
19 3300025919 Ga0207657_10840700 Ga0207657_108407002 164
20 3300031344 Ga0265316_10087615 Ga0265316_100876152 164
21 iso_pu_bacteria 2904449895 2904450564 164
22 iso_pu_bacteria 2904456579 2904456612 164
23 iso_pu_bacteria 2929520902 2929521279 164
24 iso_pu_bacteria 2945945610 2945949298 164
25 iso_pu_bacteria 2945972063 2945973347 164
26 3300005327 Ga0070658_10177398 Ga0070658_101773982 165
27 3300006195 Ga0075366_10143324 Ga0075366_101433242 165
28 3300014326 Ga0157380_10026466 Ga0157380_100264666 165
29 3300025909 Ga0207705_10202313 Ga0207705_102023132 165
30 3300048915 Ga0496112_0349230 Ga0496112_0349230_891_1406 165
31 3300050493 nmdc:mga0k408_131582_c1 nmdc:mga0k408_131582_c1_436_942 165
32 3300053088 Ga0500644_0105772 Ga0500644_0105772_255_773 165
33 3300005441 Ga0070700_100016953 Ga0070700_1000169532 166
34 3300005719 Ga0068861_100000529 Ga0068861_10000052919 166
35 3300009545 Ga0105237_10036649 Ga0105237_100366494 166
36 3300026118 Ga0207675_100002445 Ga0207675_10000244515 166
37 3300046516 Ga0495628_0179745 Ga0495628_0179745_148_669 166
38 3300003203 JGI25406J46586_10004645 JGI25406J46586_100046455 167
39 3300005336 Ga0070680_100852624 Ga0070680_1008526242 167
40 3300005344 Ga0070661_100676938 Ga0070661_1006769382 167
41 3300005981 Ga0081538_10004614 Ga0081538_100046149 167
42 3300005981 Ga0081538_10018570 Ga0081538_100185703 167
43 3300005981 Ga0081538_10038037 Ga0081538_100380373 167
44 3300005985 Ga0081539_10010991 Ga0081539_100109918 167
45 3300013102 Ga0157371_10188709 Ga0157371_101887092 167
46 3300025937 Ga0207669_10775008 Ga0207669_107750081 167
47 3300026121 Ga0207683_10261049 Ga0207683_102610491 167
48 3300031548 Ga0307408_100110361 Ga0307408_1001103613 167
49 3300031731 Ga0307405_10973530 Ga0307405_109735302 167
50 3300031824 Ga0307413_10294033 Ga0307413_102940332 167
51 3300031824 Ga0307413_10700633 Ga0307413_107006331 167
52 3300031901 Ga0307406_10011859 Ga0307406_100118593 167
53 3300031903 Ga0307407_10056401 Ga0307407_100564012 167
54 3300031911 Ga0307412_10544712 Ga0307412_105447122 167
55 3300031995 Ga0307409_100014814 Ga0307409_1000148142 167
56 3300031995 Ga0307409_100494681 Ga0307409_1004946811 167
57 3300031995 Ga0307409_100688318 Ga0307409_1006883181 167
58 3300031995 Ga0307409_101148454 Ga0307409_1011484542 167
59 3300032002 Ga0307416_100045222 Ga0307416_1000452222 167
60 3300032002 Ga0307416_100141037 Ga0307416_1001410372 167
61 3300032002 Ga0307416_100435685 Ga0307416_1004356852 167
62 3300032002 Ga0307416_101042306 Ga0307416_1010423062 167
63 3300032004 Ga0307414_10032077 Ga0307414_100320771 167
64 3300032004 Ga0307414_10156718 Ga0307414_101567182 167
65 3300032005 Ga0307411_10029624 Ga0307411_100296242 167
66 3300032005 Ga0307411_11128591 Ga0307411_111285911 167
67 3300032126 Ga0307415_100048651 Ga0307415_1000486514 167
68 3300032126 Ga0307415_100159042 Ga0307415_1001590423 167
69 3300032126 Ga0307415_100176768 Ga0307415_1001767682 167
70 3300032126 Ga0307415_101031000 Ga0307415_1010310001 167
71 3300037418 Ga0395900_0206765 Ga0395900_0206765_192_710 167
72 3300049521 Ga0501298_044591 Ga0501298_044591_271_801 167
73 3300049660 Ga0501216_054548 Ga0501216_054548_43_573 167
74 3300059421 Ga0590071_042575 Ga0590071_042575_97_627 167
75 3300059423 Ga0590074_019448 Ga0590074_019448_85_615 167
76 3300059424 Ga0590075_001149 Ga0590075_001149_3572_4102 167
77 iso_pu_bacteria 2914759650 2914759909 167
78 3300002773 JGI25152J39213_1005497 JGI25152J39213_10054972 168
79 3300003215 JGI25153J46596_10000405 JGI25153J46596_1000040518 168
80 3300003761 Ga0055535_1000047 Ga0055535_100004750 168
81 3300003763 Ga0055529_1000148 Ga0055529_100014861 168
82 3300003771 Ga0055526_1004403 Ga0055526_10044032 168
83 3300003791 Ga0055530_10005848 Ga0055530_100058482 168
84 3300003792 Ga0055540_1011028 Ga0055540_10110283 168
85 3300005262 Ga0065165_1005989 Ga0065165_10059892 168
86 3300005329 Ga0070683_100808405 Ga0070683_1008084052 168
87 3300005331 Ga0070670_100076409 Ga0070670_1000764092 168
88 3300005436 Ga0070713_100008578 Ga0070713_1000085785 168
89 3300005439 Ga0070711_100104903 Ga0070711_1001049032 168
90 3300005444 Ga0070694_100176534 Ga0070694_1001765342 168
91 3300005549 Ga0070704_100310574 Ga0070704_1003105742 168
92 3300005564 Ga0070664_100065301 Ga0070664_1000653016 168
93 3300006028 Ga0070717_10014295 Ga0070717_100142954 168
94 3300006195 Ga0075366_10656392 Ga0075366_106563922 168
95 3300006353 Ga0075370_10057508 Ga0075370_100575082 168
96 3300006353 Ga0075370_10158284 Ga0075370_101582842 168
97 3300009093 Ga0105240_10714507 Ga0105240_107145072 168
98 3300009094 Ga0111539_10783213 Ga0111539_107832132 168
99 3300009177 Ga0105248_11701686 Ga0105248_117016862 168
100 3300013104 Ga0157370_10402254 Ga0157370_104022542 168
101 3300013297 Ga0157378_10484701 Ga0157378_104847012 168
102 3300014325 Ga0163163_10000557 Ga0163163_100005577 168
103 3300014497 Ga0182008_10027811 Ga0182008_100278112 168
104 3300014497 Ga0182008_10323837 Ga0182008_103238371 168
105 3300025242 Ga0209258_100072 Ga0209258_100072218 168
106 3300025245 Ga0207425_1001619 Ga0207425_10016192 168
107 3300025254 Ga0209148_1028298 Ga0209148_10282982 168
108 3300025256 Ga0209759_1001038 Ga0209759_100103812 168
109 3300025258 Ga0209129_1000012 Ga0209129_1000012121 168
110 3300025272 Ga0209455_1000053 Ga0209455_1000053298 168
111 3300025273 Ga0209673_1007121 Ga0209673_10071215 168
112 3300025273 Ga0209673_1013690 Ga0209673_10136902 168
113 3300025292 Ga0209676_1017218 Ga0209676_10172182 168
114 3300025295 Ga0209564_1000022 Ga0209564_1000022393 168
115 3300025297 Ga0209758_1000659 Ga0209758_100065936 168
116 3300025298 Ga0209050_1000165 Ga0209050_100016544 168
117 3300025299 Ga0209256_1046335 Ga0209256_10463351 168
118 3300025303 Ga0209051_1000159 Ga0209051_100015986 168
119 3300025303 Ga0209051_1049632 Ga0209051_10496322 168
120 3300025906 Ga0207699_10031584 Ga0207699_100315842 168
121 3300025916 Ga0207663_10029401 Ga0207663_100294014 168
122 3300025924 Ga0207694_10082468 Ga0207694_100824682 168
123 3300025925 Ga0207650_10003727 Ga0207650_1000372711 168
124 3300025928 Ga0207700_10003071 Ga0207700_100030711 168
125 3300025928 Ga0207700_10338613 Ga0207700_103386132 168
126 3300025929 Ga0207664_10003703 Ga0207664_100037035 168
127 3300025939 Ga0207665_10460488 Ga0207665_104604881 168
128 3300025944 Ga0207661_10649152 Ga0207661_106491522 168
129 3300025945 Ga0207679_10027658 Ga0207679_100276586 168
130 3300025961 Ga0207712_10837006 Ga0207712_108370062 168
131 3300026142 Ga0207698_10008912 Ga0207698_100089126 168
132 3300028786 Ga0307517_10127838 Ga0307517_101278383 168
133 3300030732 Ga0316176_1157635 Ga0316176_11576351 168
134 3300031649 Ga0307514_10004934 Ga0307514_100049349 168
135 3300031731 Ga0307405_10532953 Ga0307405_105329532 168
136 3300031731 Ga0307405_11036713 Ga0307405_110367131 168
137 3300031911 Ga0307412_10103829 Ga0307412_101038292 168
138 3300031995 Ga0307409_100613663 Ga0307409_1006136632 168
139 3300035725 Ga0373947_0070733 Ga0373947_0070733_1333_1896 168
140 3300035725 Ga0373947_0278692 Ga0373947_0278692_342_917 168
141 3300036401 Ga0373937_0415303 Ga0373937_0415303_425_943 168
142 3300037853 Ga0436364_0326358 Ga0436364_0326358_589_1179 168
143 3300041511 Ga0451855_0510058 Ga0451855_0510058_213_731 168
144 3300041512 Ga0451853_1982668 Ga0451853_1982668_1115_1633 168
145 3300042876 Ga0451577_0031154 Ga0451577_0031154_1155_1667 168
146 3300046472 Ga0495580_0075406 Ga0495580_0075406_1619_2182 168
147 3300046517 Ga0495630_0383655 Ga0495630_0383655_41_604 168
148 3300046559 Ga0495667_0109052 Ga0495667_0109052_184_747 168
149 3300047319 Ga0495674_0491587 Ga0495674_0491587_398_961 168
150 3300047319 Ga0495674_0561023 Ga0495674_0561023_23_598 168
151 3300047471 Ga0495684_0592544 Ga0495684_0592544_57_620 168
152 3300050496 nmdc:mga07m45_124392_c1 nmdc:mga07m45_124392_c1_810_1325 168
153 3300053086 Ga0500578_0000007 Ga0500578_0000007_164241_164759 168
154 3300053151 Ga0500604_0076055 Ga0500604_0076055_83_601 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01661

Macro

Macro domain

30

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cb3-assembly1.cif.gz_A structural insights into the mechanism of escherichia coli ymdb 0.9829 5 167
5cb5-assembly10.cif.gz_I structural insights into the mechanism of escherichia coli ymdb 0.979 5 167
4iqy-assembly1.cif.gz_A crystal structure of the human protein-proximal adp-ribosyl-hydrolase macrod2 0.9755 5 167
6y4y-assembly1.cif.gz_A the crystal structure of human macrod2 in space group p41212 0.9721 5 167
6y73-assembly5.cif.gz_E the crystal structure of human macrod2 in space group p43 0.9719 5 167
ID Description Score Start End Superfamily
5cb5C00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.979 5 167 3.40.220.10
af_F6PBM1_89_319_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9748 5 167 3.40.220.10
af_Q3UYG8_4_243_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9724 5 167 3.40.220.10
af_Q54YH9_643_888_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9669 5 167 3.40.220.10
af_Q4DQ03_1_267_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9585 5 167 3.40.220.10
ID Description Score Start End GO Terms
AF-A0A528F0P6-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.002 10 122 GO:0019213
AF-A0A1G4XXC4-F1-model_v4 O-acetyl-ADP-ribose deacetylase (Regulator of RNase III), contains Macro domain 1.001 2 167 GO:0061463
AF-A0A5F2HVQ7-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.001 10 125 GO:0061463
AF-A0A357Z310-F1-model_v4 RNase III inhibitor 1.001 8 125 GO:0019213
AF-A0A644WLU7-F1-model_v4 O-acetyl-ADP-ribose deacetylase (EC 3.5.1.-) 1.001 8 106 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.86 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map