F220103

General Info

Members Datasets Scaffolds Average Seq Length
154 121 308 152

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0001546|Ga0373956_0001546_3272_3754
Length 160
Sequence MRVGIGSDVHPIRPGRECWLAGLRWDGVDGCAGHSDGDVAAHALCDAVLSAAGLPEVGGDLGEVFGTDDPRWAGAHGVQFLAEVRDRLAAAGWRVGNAAVQVIGRRPRLSVRRLEAQQVLSAALGAPVTVSATTTDGLGLTGRGEGIAAIATALVLRTGE

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
39 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
67 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
68 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
112 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
113 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
114 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
115 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
116 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
117 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
118 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
119 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
120 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
121 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.65
Isolates 6.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 2.6
Rhizosphere 85.71
Stem 0
Stem Tuber 0.65
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0001546 3300035119 Bacteria 9492
2 Ga0070658_10336563 3300005327 Bacteria 1290
3 Ga0070676_10707690 3300005328 Bacteria 736
4 Ga0070670_100176255 3300005331 Bacteria 1855
5 Ga0068868_100218892 3300005338 Bacteria 1593
6 Ga0070691_10131950 3300005341 Bacteria 1267
7 Ga0070687_100444665 3300005343 Bacteria 861
8 Ga0070668_100471211 3300005347 Bacteria 1083
9 Ga0070714_100896360 3300005435 Bacteria 861
10 Ga0070714_101223139 3300005435 Bacteria 733
11 Ga0070710_10000085 3300005437 Bacteria 42670
12 Ga0070701_10248046 3300005438 Bacteria 1074
13 Ga0070663_100690697 3300005455 Bacteria 866
14 Ga0070685_10204806 3300005466 Bacteria 1284
15 Ga0070699_100450211 3300005518 Bacteria 1167
16 Ga0070679_100335997 3300005530 Bacteria 1459
17 Ga0070672_100124545 3300005543 Bacteria 2113
18 Ga0070665_100150613 3300005548 Bacteria 2329
19 Ga0070664_100191674 3300005564 Bacteria 1821
20 Ga0070702_100509249 3300005615 Bacteria 885
21 Ga0068852_100087684 3300005616 Bacteria 2777
22 Ga0068864_100275298 3300005618 Bacteria 1569
23 Ga0068851_10091037 3300005834 Bacteria 1605
24 Ga0068870_10145218 3300005840 Bacteria 1392
25 Ga0068860_100274693 3300005843 Bacteria 1645
26 Ga0070717_10615095 3300006028 Bacteria 986
27 Ga0075365_10038027 3300006038 Bacteria 3126
28 Ga0075364_10022397 3300006051 Bacteria 3989
29 Ga0075428_101707770 3300006844 Bacteria 657
30 Ga0075428_102404456 3300006844 Bacteria 541
31 Ga0075430_100304620 3300006846 Bacteria 1318
32 Ga0075429_100059296 3300006880 Bacteria 3334
33 Ga0068865_100186451 3300006881 Bacteria 1601
34 Ga0105251_10347600 3300009011 Bacteria 676
35 Ga0111539_10373894 3300009094 Bacteria 1659
36 Ga0105247_10378592 3300009101 Bacteria 1003
37 Ga0105243_11199441 3300009148 Bacteria 772
38 Ga0105243_11518432 3300009148 Bacteria 694
39 Ga0105241_10125325 3300009174 Bacteria 2073
40 Ga0105249_10280008 3300009553 Bacteria 1665
41 Ga0105029_100451 3300009984 Bacteria 2199
42 Ga0105028_110153 3300009993 Bacteria 988
43 Ga0105239_10299337 3300010375 Bacteria 1811
44 Ga0157374_10698839 3300013296 Bacteria 1027
45 Ga0163162_10131171 3300013306 Bacteria 2615
46 Ga0157372_10534959 3300013307 Bacteria 1366
47 Ga0157375_10867700 3300013308 Bacteria 1048
48 Ga0163163_10220834 3300014325 Bacteria 1944
49 Ga0163163_11206763 3300014325 Bacteria 819
50 Ga0157380_11252004 3300014326 Bacteria 787
51 Ga0157377_10075613 3300014745 Bacteria 1956
52 Ga0157379_10288458 3300014968 Bacteria 1494
53 Ga0197907_10550733 3300020069 Bacteria 718
54 Ga0213871_10083998 3300021441 Bacteria 916
55 Ga0207692_10000242 3300025898 Bacteria 18530
56 Ga0207645_10029696 3300025907 Bacteria 3523
57 Ga0207663_11134506 3300025916 Bacteria 629
58 Ga0207662_10918436 3300025918 Bacteria 620
59 Ga0207652_10291831 3300025921 Bacteria 1471
60 Ga0207681_10650146 3300025923 Bacteria 874
61 Ga0207644_10101338 3300025931 Bacteria 2164
62 Ga0207658_10319456 3300025986 Bacteria 1344
63 Ga0207703_10297395 3300026035 Bacteria 1471
64 Ga0207678_10370161 3300026067 Bacteria 1238
65 Ga0207678_10660293 3300026067 Bacteria 919
66 Ga0207676_10061471 3300026095 Bacteria 2974
67 Ga0207683_10175774 3300026121 Bacteria 1940
68 Ga0268264_10074667 3300028381 Bacteria 2881
69 Ga0307517_10305674 3300028786 Bacteria 889
70 Ga0307512_10050286 3300030522 Bacteria 3349
71 Ga0316177_1166065 3300030731 Bacteria 3304
72 Ga0316176_1097657 3300030732 Bacteria 3475
73 Ga0314311_1204576 3300030733 Bacteria 6829
74 Ga0307513_10013558 3300031456 Bacteria 9997
75 Ga0307513_10155058 3300031456 Bacteria 2191
76 Ga0307509_10052778 3300031507 Bacteria 4339
77 Ga0307413_10072632 3300031824 Bacteria 2172
78 Ga0307413_10091642 3300031824 Bacteria 1981
79 Ga0307409_100186935 3300031995 Bacteria 1840
80 Ga0307415_100043755 3300032126 Bacteria 2990
81 Ga0307507_10049053 3300033179 Bacteria 4098
82 Ga0373931_0106334 3300035691 Bacteria 1586
83 Ga0395900_0230686 3300037418 Bacteria 1862
84 Ga0395901_1268745 3300038443 Bacteria 700
85 Ga0436360_1040395 3300039438 Bacteria 1022
86 Ga0439449_0042610 3300042007 Bacteria 1686
87 Ga0466972_0004648 3300044658 Bacteria 6875
88 Ga0466972_0024731 3300044658 Bacteria 2980
89 Ga0466972_0124002 3300044658 Bacteria 1217
90 Ga0466965_0002241 3300044683 Bacteria 8147
91 Ga0466965_0007955 3300044683 Bacteria 4888
92 Ga0466965_0015069 3300044683 Bacteria 3669
93 Ga0466965_0024145 3300044683 Bacteria 2939
94 Ga0466965_0274729 3300044683 Bacteria 909
95 Ga0466966_0008190 3300044684 Bacteria 6928
96 Ga0466961_0082499 3300044693 Bacteria 2034
97 Ga0466963_0032404 3300044694 Bacteria 3384
98 Ga0466963_0054117 3300044694 Bacteria 2667
99 Ga0466964_0091371 3300044706 Bacteria 1325
100 Ga0466964_0137000 3300044706 Bacteria 1121
101 Ga0466971_0035274 3300044719 Bacteria 2242
102 Ga0466971_0317767 3300044719 Bacteria 750
103 Ga0466968_0011516 3300044735 Bacteria 3447
104 Ga0466970_0020533 3300044765 Bacteria 3433
105 Ga0466970_0025387 3300044765 Bacteria 3102
106 Ga0466970_0029990 3300044765 Bacteria 2867
107 Ga0466957_0021241 3300044842 Bacteria 3824
108 Ga0466957_0372356 3300044842 Bacteria 973
109 Ga0466960_0015921 3300044901 Bacteria 3250
110 Ga0466960_0087269 3300044901 Bacteria 1583
111 Ga0466960_0207795 3300044901 Bacteria 1072
112 Ga0466960_0317759 3300044901 Bacteria 881
113 Ga0466960_0362556 3300044901 Bacteria 829
114 Ga0466959_0019624 3300045049 Bacteria 4972
115 Ga0466959_0097524 3300045049 Bacteria 2107
116 Ga0466958_0049636 3300045836 Bacteria 2539
117 Ga0466958_0073064 3300045836 Bacteria 2101
118 Ga0466967_0039486 3300045976 Bacteria 4059
119 Ga0466967_0248333 3300045976 Bacteria 1699
120 Ga0466967_0310569 3300045976 Bacteria 1519
121 Ga0466967_0387337 3300045976 Bacteria 1358
122 Ga0466967_0666670 3300045976 Bacteria 1029
123 Ga0466967_1313608 3300045976 Bacteria 720
124 Ga0495650_0180613 3300046471 Bacteria 742
125 Ga0495683_0004080 3300047323 Bacteria 8366
126 Ga0496100_0487185 3300048903 Bacteria 949
127 Ga0496110_0196678 3300048913 Bacteria 1831
128 Ga0496110_1394272 3300048913 Bacteria 610
129 Ga0496113_0386947 3300048916 Bacteria 1123
130 Ga0501034_0391897 3300049571 Bacteria 1313
131 Ga0501047_1031077 3300049581 Bacteria 636
132 Ga0501068_0549182 3300049584 Bacteria 751
133 Ga0501070_0040589 3300049586 Bacteria 3881
134 Ga0501070_0705601 3300049586 Bacteria 798
135 Ga0501073_0199647 3300049589 Bacteria 1383
136 Ga0501073_0359216 3300049589 Bacteria 1006
137 Ga0501083_0294915 3300049744 Bacteria 1055
138 nmdc:mga00v17_136184_c1 3300050491 Bacteria 1572
139 nmdc:mga0yw44_44937_c1 3300050492 Bacteria 2645
140 nmdc:mga07m45_337292_c1 3300050496 Bacteria 876
141 nmdc:mga09592_31702_c1 3300050508 Bacteria 4404
142 nmdc:mga0qj67_329169_c1 3300050509 Bacteria 1236
143 nmdc:mga08y16_292580_c1 3300050511 Bacteria 1679
144 nmdc:mga0sz30_53806_c1 3300050516 Bacteria 1711
145 2791916526 2791354901 Bacteria 8322202
146 2795780337 2795385470 Bacteria 8317180
147 2816505952 2816332139 Bacteria 9138787
148 2832005785 2832004796 Bacteria 6538017
149 2866068838 2866065130 Bacteria 6518152
150 2899366124 2899359706 Bacteria 10940472
151 2899374719 2899370129 Bacteria 6781179
152 2917739032 2917736166 Bacteria 9690793
153 2919718047 2919713450 Bacteria 7431245
154 8054474095 8054472261 Bacteria 7464355
155 Ga0373956_0001546
156 Ga0070658_10336563
157 Ga0070676_10707690
158 Ga0070670_100176255
159 Ga0068868_100218892
160 Ga0070691_10131950
161 Ga0070687_100444665
162 Ga0070668_100471211
163 Ga0070714_100896360
164 Ga0070714_101223139
165 Ga0070710_10000085
166 Ga0070701_10248046
167 Ga0070663_100690697
168 Ga0070685_10204806
169 Ga0070699_100450211
170 Ga0070679_100335997
171 Ga0070672_100124545
172 Ga0070665_100150613
173 Ga0070664_100191674
174 Ga0070702_100509249
175 Ga0068852_100087684
176 Ga0068864_100275298
177 Ga0068851_10091037
178 Ga0068870_10145218
179 Ga0068860_100274693
180 Ga0070717_10615095
181 Ga0075365_10038027
182 Ga0075364_10022397
183 Ga0075428_101707770
184 Ga0075428_102404456
185 Ga0075430_100304620
186 Ga0075429_100059296
187 Ga0068865_100186451
188 Ga0105251_10347600
189 Ga0111539_10373894
190 Ga0105247_10378592
191 Ga0105243_11199441
192 Ga0105243_11518432
193 Ga0105241_10125325
194 Ga0105249_10280008
195 Ga0105029_100451
196 Ga0105028_110153
197 Ga0105239_10299337
198 Ga0157374_10698839
199 Ga0163162_10131171
200 Ga0157372_10534959
201 Ga0157375_10867700
202 Ga0163163_10220834
203 Ga0163163_11206763
204 Ga0157380_11252004
205 Ga0157377_10075613
206 Ga0157379_10288458
207 Ga0197907_10550733
208 Ga0213871_10083998
209 Ga0207692_10000242
210 Ga0207645_10029696
211 Ga0207663_11134506
212 Ga0207662_10918436
213 Ga0207652_10291831
214 Ga0207681_10650146
215 Ga0207644_10101338
216 Ga0207658_10319456
217 Ga0207703_10297395
218 Ga0207678_10370161
219 Ga0207678_10660293
220 Ga0207676_10061471
221 Ga0207683_10175774
222 Ga0268264_10074667
223 Ga0307517_10305674
224 Ga0307512_10050286
225 Ga0316177_1166065
226 Ga0316176_1097657
227 Ga0314311_1204576
228 Ga0307513_10013558
229 Ga0307513_10155058
230 Ga0307509_10052778
231 Ga0307413_10072632
232 Ga0307413_10091642
233 Ga0307409_100186935
234 Ga0307415_100043755
235 Ga0307507_10049053
236 Ga0373931_0106334
237 Ga0395900_0230686
238 Ga0395901_1268745
239 Ga0436360_1040395
240 Ga0439449_0042610
241 Ga0466972_0004648
242 Ga0466972_0024731
243 Ga0466972_0124002
244 Ga0466965_0002241
245 Ga0466965_0007955
246 Ga0466965_0015069
247 Ga0466965_0024145
248 Ga0466965_0274729
249 Ga0466966_0008190
250 Ga0466961_0082499
251 Ga0466963_0032404
252 Ga0466963_0054117
253 Ga0466964_0091371
254 Ga0466964_0137000
255 Ga0466971_0035274
256 Ga0466971_0317767
257 Ga0466968_0011516
258 Ga0466970_0020533
259 Ga0466970_0025387
260 Ga0466970_0029990
261 Ga0466957_0021241
262 Ga0466957_0372356
263 Ga0466960_0015921
264 Ga0466960_0087269
265 Ga0466960_0207795
266 Ga0466960_0317759
267 Ga0466960_0362556
268 Ga0466959_0019624
269 Ga0466959_0097524
270 Ga0466958_0049636
271 Ga0466958_0073064
272 Ga0466967_0039486
273 Ga0466967_0248333
274 Ga0466967_0310569
275 Ga0466967_0387337
276 Ga0466967_0666670
277 Ga0466967_1313608
278 Ga0495650_0180613
279 Ga0495683_0004080
280 Ga0496100_0487185
281 Ga0496110_0196678
282 Ga0496110_1394272
283 Ga0496113_0386947
284 Ga0501034_0391897
285 Ga0501047_1031077
286 Ga0501068_0549182
287 Ga0501070_0040589
288 Ga0501070_0705601
289 Ga0501073_0199647
290 Ga0501073_0359216
291 Ga0501083_0294915
292 nmdc:mga00v17_136184_c1
293 nmdc:mga0yw44_44937_c1
294 nmdc:mga07m45_337292_c1
295 nmdc:mga09592_31702_c1
296 nmdc:mga0qj67_329169_c1
297 nmdc:mga08y16_292580_c1
298 nmdc:mga0sz30_53806_c1
299 2791916526
300 2795780337
301 2816505952
302 2832005785
303 2866068838
304 2899366124
305 2899374719
306 2917739032
307 2919718047
308 8054474095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

1

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9772 2 153
2uzh-assembly1.cif.gz_B mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9678 2 153
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9525 2 153
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.951 2 153
5iwx-assembly1.cif.gz_A crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9508 2 153
ID Description Score Start End Superfamily
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9692 2 153 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9445 2 153 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9417 2 153 3.30.1330.50
1iv1B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9284 2 152 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9276 2 156 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A7W0XUS7-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) 0.9859 1 135 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-C8XAB3-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.9843 2 154 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518
AF-A0A7G8WR02-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.9824 2 153 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518
AF-A0A1V2I2R9-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9817 2 151 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A2N3FN10-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9812 1 153 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Map