F219252

General Info

Members Datasets Scaffolds Average Seq Length
154 70 153 270

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10019271|Ga0070717_100192712
Length 283
Sequence VSPARRNRTAHEQKAIAVEPESVKQCCARLYESDVAKLLLGESFHPGGLKLTQRIGEILGLGPENRVLDVASGKGTSAMFLAQHFGCEVVGIDYGNHNVETANHEAAVKGLGTRVRFERADAELLPIPDGSFCAVICECAFCTFPNKTAAAAEFMRVLRAGGQVGLCDLTRAPALPKALDGLLAWVACVADAQPIESYVATLHAAGLMVEHIELHNESLSELVQQVRAKLLGAEIMVGLKKLDLPGVDFRTAKQMVKDVIVAIEQNQLGYALITANKPMIASP

Samples

Sample ID Description Type Environment
1 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
19 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
36 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
37 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
38 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
39 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
40 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
41 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
42 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
55 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
56 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
57 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
58 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
59 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
60 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
65 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
66 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
67 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
68 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
69 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
70 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.65
Rhizoplane 0
Rhizosphere 97.4
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100013684 3300005435 Bacteria 6507
2 Ga0070714_100377340 3300005435 Unclassified 1336
3 Ga0070714_100681473 3300005435 Bacteria 991
4 Ga0070713_100021691 3300005436 Unclassified 4947
5 Ga0070708_100000596 3300005445 Bacteria 27184
6 Ga0070708_100028593 3300005445 Bacteria 4799
7 Ga0070708_100063522 3300005445 Bacteria 3305
8 Ga0070708_100090048 3300005445 Bacteria 2792
9 Ga0070708_100216144 3300005445 Bacteria 1797
10 Ga0070708_100584126 3300005445 Unclassified 1053
11 Ga0070681_10142405 3300005458 Bacteria 2327
12 Ga0070706_100000318 3300005467 Bacteria 58661
13 Ga0070706_100000459 3300005467 Bacteria 48582
14 Ga0070706_100000510 3300005467 Bacteria 45609
15 Ga0070706_100004867 3300005467 Bacteria 12860
16 Ga0070706_100029646 3300005467 Bacteria 5041
17 Ga0070706_100052056 3300005467 Bacteria 3780
18 Ga0070706_100076119 3300005467 Bacteria 3106
19 Ga0070706_100127443 3300005467 Bacteria 2374
20 Ga0070706_100304924 3300005467 Bacteria 1485
21 Ga0070707_100000142 3300005468 Bacteria 67685
22 Ga0070707_100018966 3300005468 Bacteria 6479
23 Ga0070707_100024596 3300005468 Bacteria 5705
24 Ga0070707_100060697 3300005468 Unclassified 3626
25 Ga0070707_100091548 3300005468 Bacteria 2944
26 Ga0070707_100094406 3300005468 Bacteria 2896
27 Ga0070707_100095764 3300005468 Bacteria 2875
28 Ga0070707_100134576 3300005468 Bacteria 2404
29 Ga0070707_100209386 3300005468 Bacteria 1900
30 Ga0070707_100292769 3300005468 Bacteria 1582
31 Ga0070707_100294535 3300005468 Bacteria 1577
32 Ga0070707_100374286 3300005468 Bacteria 1384
33 Ga0070698_100000838 3300005471 Bacteria 33646
34 Ga0070698_100002546 3300005471 Bacteria 20084
35 Ga0070698_100006908 3300005471 Bacteria 12301
36 Ga0070698_100023000 3300005471 Bacteria 6517
37 Ga0070698_100056994 3300005471 Unclassified 3955
38 Ga0070698_100094884 3300005471 Bacteria 2961
39 Ga0070698_100099574 3300005471 Bacteria 2880
40 Ga0070698_100112725 3300005471 Bacteria 2684
41 Ga0070698_100116273 3300005471 Bacteria 2638
42 Ga0070698_100123996 3300005471 Bacteria 2541
43 Ga0070698_100208156 3300005471 Bacteria 1891
44 Ga0070698_100239190 3300005471 Bacteria 1749
45 Ga0070698_100330220 3300005471 Unclassified 1456
46 Ga0070698_100431391 3300005471 Bacteria 1253
47 Ga0070699_100000365 3300005518 Bacteria 44283
48 Ga0070699_100000597 3300005518 Bacteria 33983
49 Ga0070699_100068743 3300005518 Bacteria 3077
50 Ga0070699_100126418 3300005518 Unclassified 2251
51 Ga0070699_100389740 3300005518 Bacteria 1259
52 Ga0070699_100397901 3300005518 Bacteria 1245
53 Ga0070699_100518696 3300005518 Bacteria 1083
54 Ga0070699_100545320 3300005518 Bacteria 1055
55 Ga0070679_100086825 3300005530 Bacteria 3115
56 Ga0070684_100170627 3300005535 Bacteria 1976
57 Ga0070697_100040295 3300005536 Bacteria 3778
58 Ga0070697_100066061 3300005536 Bacteria 2957
59 Ga0068855_100194460 3300005563 Bacteria 2286
60 Ga0068857_100174635 3300005577 Bacteria 1954
61 Ga0081538_10044590 3300005981 Bacteria 2763
62 Ga0070717_10001522 3300006028 Bacteria 16059
63 Ga0070717_10007531 3300006028 Bacteria 8089
64 Ga0070717_10012240 3300006028 Bacteria 6542
65 Ga0070717_10019271 3300006028 Bacteria 5349
66 Ga0070717_10048104 3300006028 Unclassified 3497
67 Ga0070717_10065205 3300006028 Bacteria 3027
68 Ga0070717_10094344 3300006028 Bacteria 2531
69 Ga0075436_100025068 3300006914 Bacteria 4101
70 Ga0099794_10000781 3300007265 Bacteria 10754
71 Ga0099794_10012001 3300007265 Bacteria 3726
72 Ga0099794_10034385 3300007265 Bacteria 2387
73 Ga0099794_10068601 3300007265 Bacteria 1734
74 Ga0099794_10124450 3300007265 Bacteria 1299
75 Ga0099795_10000824 3300007788 Bacteria 6141
76 Ga0105240_10009053 3300009093 Bacteria 14137
77 Ga0105240_10311920 3300009093 Bacteria 1796
78 Ga0114129_10006918 3300009147 Bacteria 16137
79 Ga0114129_10011616 3300009147 Bacteria 12538
80 Ga0099796_10085285 3300010159 Unclassified 1165
81 Ga0157374_10241502 3300013296 Bacteria 1776
82 Ga0207653_10025698 3300025885 Bacteria 1884
83 Ga0207692_10415706 3300025898 Bacteria 841
84 Ga0207684_10000012 3300025910 Bacteria 478666
85 Ga0207684_10000321 3300025910 Bacteria 68294
86 Ga0207684_10000554 3300025910 Bacteria 45999
87 Ga0207684_10008951 3300025910 Bacteria 8879
88 Ga0207684_10010474 3300025910 Bacteria 8160
89 Ga0207684_10059674 3300025910 Bacteria 3239
90 Ga0207684_10105641 3300025910 Bacteria 2409
91 Ga0207684_10135653 3300025910 Bacteria 2113
92 Ga0207684_10150704 3300025910 Bacteria 2001
93 Ga0207684_10218203 3300025910 Bacteria 1646
94 Ga0207671_10238495 3300025914 Unclassified 1428
95 Ga0207652_10391369 3300025921 Bacteria 1254
96 Ga0207646_10000047 3300025922 Bacteria 172446
97 Ga0207646_10003909 3300025922 Bacteria 16542
98 Ga0207646_10006095 3300025922 Bacteria 12560
99 Ga0207646_10011137 3300025922 Bacteria 8729
100 Ga0207646_10029413 3300025922 Bacteria 4993
101 Ga0207646_10053064 3300025922 Bacteria 3627
102 Ga0207646_10087451 3300025922 Bacteria 2789
103 Ga0207646_10155587 3300025922 Bacteria 2062
104 Ga0207646_10241193 3300025922 Bacteria 1633
105 Ga0207700_10006819 3300025928 Bacteria 6942
106 Ga0207664_10076028 3300025929 Unclassified 2717
107 Ga0207661_10046249 3300025944 Bacteria 3451
108 Ga0207667_10299953 3300025949 Bacteria 1642
109 Ga0209588_1000395 3300027671 Bacteria 11303
110 Ga0209588_1067422 3300027671 Unclassified 1156
111 Ga0373926_0030897 3300035083 Bacteria 1888
112 Ga0373954_0000438 3300035118 Bacteria 15567
113 Ga0373954_0037071 3300035118 Bacteria 2265
114 Ga0373956_0002308 3300035119 Bacteria 7846
115 Ga0373935_0100347 3300035692 Bacteria 1907
116 Ga0373927_0000189 3300035695 Bacteria 49133
117 Ga0373927_0000237 3300035695 Bacteria 43114
118 Ga0373947_0003064 3300035725 Bacteria 9948
119 Ga0373937_0019267 3300036401 Bacteria 6107
120 Ga0373937_0576135 3300036401 Unclassified 1069
121 Ga0373937_0595846 3300036401 Bacteria 1049
122 Ga0373925_0001487 3300037068 Bacteria 20123
123 Ga0436364_0449524 3300037853 Bacteria 5228
124 Ga0436364_0889541 3300037853 Bacteria 1513
125 Ga0436365_1518161 3300039437 Bacteria 10073
126 Ga0453683_0004448 3300044673 Bacteria 9944
127 Ga0466966_0060684 3300044684 Bacteria 2386
128 Ga0466961_0005502 3300044693 Bacteria 7990
129 Ga0453684_0122673 3300044712 Bacteria 3134
130 Ga0466970_0089144 3300044765 Bacteria 1673
131 Ga0466957_0001647 3300044842 Bacteria 11722
132 Ga0466959_0019511 3300045049 Unclassified 4985
133 Ga0466958_0004480 3300045836 Bacteria 7370
134 Ga0495603_0177147 3300046455 Unclassified 1234
135 Ga0495630_0212082 3300046517 Unclassified 1478
136 Ga0495630_0297337 3300046517 Unclassified 1234
137 Ga0495640_0064109 3300046533 Bacteria 2486
138 Ga0495613_0094252 3300046689 Bacteria 2167
139 Ga0495624_0083889 3300046690 Bacteria 1970
140 Ga0495674_0079673 3300047319 Bacteria 2812
141 Ga0495684_0048668 3300047471 Bacteria 3241
142 Ga0495602_0015112 3300048088 Bacteria 7805
143 Ga0501034_0047921 3300049571 Bacteria 4313
144 Ga0501038_0113075 3300049574 Bacteria 2247
145 Ga0501047_0049435 3300049581 Bacteria 4061
146 Ga0501072_0380771 3300049588 Bacteria 1120
147 Ga0501044_0066042 3300049823 Bacteria 3689
148 nmdc:mga05p37_22114_c1 3300050507 Bacteria 7709
149 nmdc:mga05p37_275091_c1 3300050507 Bacteria 2011
150 nmdc:mga0n895_540315_c1 3300050512 Bacteria 1172
151 nmdc:mga08x19_20014_c1 3300050514 Bacteria 4117
152 nmdc:mga0a205_96548_c1 3300050515 Bacteria 2854
153 Ga0466962_0012780 3300061719 Unclassified 4039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100023000 Ga0070698_1000230001 223
2 3300037853 Ga0436364_0889541 Ga0436364_0889541_781_1488 230
3 3300025898 Ga0207692_10415706 Ga0207692_104157061 233
4 iso_pu_bacteria 2876761206 2876763523 239
5 3300007265 Ga0099794_10068601 Ga0099794_100686012 240
6 3300025914 Ga0207671_10238495 Ga0207671_102384952 244
7 3300049588 Ga0501072_0380771 Ga0501072_0380771_207_1040 248
8 3300009093 Ga0105240_10009053 Ga0105240_100090533 252
9 3300005518 Ga0070699_100000597 Ga0070699_10000059740 257
10 3300005981 Ga0081538_10044590 Ga0081538_100445902 258
11 3300039437 Ga0436365_1518161 Ga0436365_1518161_1999_2799 261
12 3300005458 Ga0070681_10142405 Ga0070681_101424052 262
13 3300005535 Ga0070684_100170627 Ga0070684_1001706272 262
14 3300005577 Ga0068857_100174635 Ga0068857_1001746352 262
15 3300013296 Ga0157374_10241502 Ga0157374_102415022 262
16 3300025944 Ga0207661_10046249 Ga0207661_100462492 262
17 3300035083 Ga0373926_0030897 Ga0373926_0030897_381_1187 262
18 3300035692 Ga0373935_0100347 Ga0373935_0100347_865_1671 262
19 3300035695 Ga0373927_0000189 Ga0373927_0000189_26970_27776 262
20 3300035725 Ga0373947_0003064 Ga0373947_0003064_2423_3229 262
21 3300036401 Ga0373937_0019267 Ga0373937_0019267_1251_2051 262
22 3300036401 Ga0373937_0576135 Ga0373937_0576135_68_859 262
23 3300037068 Ga0373925_0001487 Ga0373925_0001487_5080_5886 262
24 3300046517 Ga0495630_0212082 Ga0495630_0212082_349_1155 262
25 3300046690 Ga0495624_0083889 Ga0495624_0083889_1074_1880 262
26 3300048088 Ga0495602_0015112 Ga0495602_0015112_3258_4049 262
27 3300005445 Ga0070708_100216144 Ga0070708_1002161443 263
28 3300005468 Ga0070707_100018966 Ga0070707_1000189665 264
29 3300005471 Ga0070698_100000838 Ga0070698_10000083815 264
30 3300005471 Ga0070698_100239190 Ga0070698_1002391902 264
31 3300005471 Ga0070698_100431391 Ga0070698_1004313912 264
32 3300005518 Ga0070699_100397901 Ga0070699_1003979012 264
33 3300009147 Ga0114129_10006918 Ga0114129_100069186 264
34 3300009147 Ga0114129_10011616 Ga0114129_100116162 264
35 3300025910 Ga0207684_10135653 Ga0207684_101356531 264
36 3300025910 Ga0207684_10150704 Ga0207684_101507042 264
37 3300025922 Ga0207646_10003909 Ga0207646_100039095 264
38 3300046689 Ga0495613_0094252 Ga0495613_0094252_798_1631 264
39 3300047319 Ga0495674_0079673 Ga0495674_0079673_1091_1924 264
40 3300047471 Ga0495684_0048668 Ga0495684_0048668_1088_1921 264
41 3300050507 nmdc:mga05p37_22114_c1 nmdc:mga05p37_22114_c1_2009_2803 264
42 3300050507 nmdc:mga05p37_275091_c1 nmdc:mga05p37_275091_c1_1166_1996 264
43 3300050512 nmdc:mga0n895_540315_c1 nmdc:mga0n895_540315_c1_78_890 264
44 3300050515 nmdc:mga0a205_96548_c1 nmdc:mga0a205_96548_c1_248_1042 264
45 3300005435 Ga0070714_100681473 Ga0070714_1006814731 266
46 3300005445 Ga0070708_100063522 Ga0070708_1000635223 266
47 3300005467 Ga0070706_100076119 Ga0070706_1000761193 266
48 3300005468 Ga0070707_100024596 Ga0070707_1000245962 266
49 3300005471 Ga0070698_100002546 Ga0070698_10000254615 266
50 3300005518 Ga0070699_100545320 Ga0070699_1005453202 266
51 3300007788 Ga0099795_10000824 Ga0099795_100008245 266
52 3300010159 Ga0099796_10085285 Ga0099796_100852852 266
53 3300025910 Ga0207684_10059674 Ga0207684_100596743 266
54 3300025922 Ga0207646_10011137 Ga0207646_100111378 266
55 3300049571 Ga0501034_0047921 Ga0501034_0047921_3089_3907 266
56 3300049574 Ga0501038_0113075 Ga0501038_0113075_806_1624 266
57 3300049581 Ga0501047_0049435 Ga0501047_0049435_2224_3033 266
58 3300049823 Ga0501044_0066042 Ga0501044_0066042_514_1332 266
59 3300005435 Ga0070714_100013684 Ga0070714_1000136843 267
60 3300005435 Ga0070714_100377340 Ga0070714_1003773402 267
61 3300005436 Ga0070713_100021691 Ga0070713_1000216912 267
62 3300005445 Ga0070708_100000596 Ga0070708_1000005967 267
63 3300005445 Ga0070708_100028593 Ga0070708_1000285936 267
64 3300005445 Ga0070708_100090048 Ga0070708_1000900481 267
65 3300005445 Ga0070708_100584126 Ga0070708_1005841261 267
66 3300005467 Ga0070706_100000318 Ga0070706_1000003183 267
67 3300005467 Ga0070706_100000459 Ga0070706_10000045911 267
68 3300005467 Ga0070706_100000510 Ga0070706_10000051018 267
69 3300005467 Ga0070706_100004867 Ga0070706_1000048674 267
70 3300005467 Ga0070706_100029646 Ga0070706_1000296462 267
71 3300005467 Ga0070706_100052056 Ga0070706_1000520562 267
72 3300005467 Ga0070706_100127443 Ga0070706_1001274433 267
73 3300005467 Ga0070706_100304924 Ga0070706_1003049242 267
74 3300005468 Ga0070707_100000142 Ga0070707_1000001425 267
75 3300005468 Ga0070707_100060697 Ga0070707_1000606972 267
76 3300005468 Ga0070707_100091548 Ga0070707_1000915483 267
77 3300005468 Ga0070707_100094406 Ga0070707_1000944062 267
78 3300005468 Ga0070707_100095764 Ga0070707_1000957642 267
79 3300005468 Ga0070707_100134576 Ga0070707_1001345762 267
80 3300005468 Ga0070707_100209386 Ga0070707_1002093862 267
81 3300005468 Ga0070707_100292769 Ga0070707_1002927692 267
82 3300005468 Ga0070707_100294535 Ga0070707_1002945351 267
83 3300005468 Ga0070707_100374286 Ga0070707_1003742862 267
84 3300005471 Ga0070698_100006908 Ga0070698_1000069085 267
85 3300005471 Ga0070698_100056994 Ga0070698_1000569942 267
86 3300005471 Ga0070698_100094884 Ga0070698_1000948843 267
87 3300005471 Ga0070698_100099574 Ga0070698_1000995741 267
88 3300005471 Ga0070698_100112725 Ga0070698_1001127252 267
89 3300005471 Ga0070698_100116273 Ga0070698_1001162732 267
90 3300005471 Ga0070698_100123996 Ga0070698_1001239962 267
91 3300005471 Ga0070698_100208156 Ga0070698_1002081563 267
92 3300005471 Ga0070698_100330220 Ga0070698_1003302202 267
93 3300005518 Ga0070699_100000365 Ga0070699_1000003657 267
94 3300005518 Ga0070699_100068743 Ga0070699_1000687431 267
95 3300005518 Ga0070699_100126418 Ga0070699_1001264182 267
96 3300005518 Ga0070699_100389740 Ga0070699_1003897402 267
97 3300005518 Ga0070699_100518696 Ga0070699_1005186961 267
98 3300005530 Ga0070679_100086825 Ga0070679_1000868252 267
99 3300005536 Ga0070697_100040295 Ga0070697_1000402951 267
100 3300005536 Ga0070697_100066061 Ga0070697_1000660613 267
101 3300005563 Ga0068855_100194460 Ga0068855_1001944602 267
102 3300006028 Ga0070717_10001522 Ga0070717_1000152217 267
103 3300006028 Ga0070717_10007531 Ga0070717_100075313 267
104 3300006028 Ga0070717_10012240 Ga0070717_100122402 267
105 3300006028 Ga0070717_10019271 Ga0070717_100192712 267
106 3300006028 Ga0070717_10048104 Ga0070717_100481044 267
107 3300006028 Ga0070717_10065205 Ga0070717_100652052 267
108 3300006028 Ga0070717_10094344 Ga0070717_100943443 267
109 3300006914 Ga0075436_100025068 Ga0075436_1000250686 267
110 3300007265 Ga0099794_10000781 Ga0099794_1000078112 267
111 3300007265 Ga0099794_10012001 Ga0099794_100120012 267
112 3300007265 Ga0099794_10034385 Ga0099794_100343851 267
113 3300007265 Ga0099794_10124450 Ga0099794_101244502 267
114 3300009093 Ga0105240_10311920 Ga0105240_103119202 267
115 3300025885 Ga0207653_10025698 Ga0207653_100256982 267
116 3300025910 Ga0207684_10000012 Ga0207684_10000012494 267
117 3300025910 Ga0207684_10000321 Ga0207684_1000032142 267
118 3300025910 Ga0207684_10000554 Ga0207684_1000055419 267
119 3300025910 Ga0207684_10008951 Ga0207684_100089518 267
120 3300025910 Ga0207684_10010474 Ga0207684_100104746 267
121 3300025910 Ga0207684_10105641 Ga0207684_101056412 267
122 3300025910 Ga0207684_10218203 Ga0207684_102182032 267
123 3300025921 Ga0207652_10391369 Ga0207652_103913692 267
124 3300025922 Ga0207646_10000047 Ga0207646_1000004773 267
125 3300025922 Ga0207646_10006095 Ga0207646_1000609513 267
126 3300025922 Ga0207646_10029413 Ga0207646_100294132 267
127 3300025922 Ga0207646_10053064 Ga0207646_100530642 267
128 3300025922 Ga0207646_10087451 Ga0207646_100874513 267
129 3300025922 Ga0207646_10155587 Ga0207646_101555872 267
130 3300025922 Ga0207646_10241193 Ga0207646_102411933 267
131 3300025928 Ga0207700_10006819 Ga0207700_100068193 267
132 3300025929 Ga0207664_10076028 Ga0207664_100760282 267
133 3300025949 Ga0207667_10299953 Ga0207667_102999532 267
134 3300027671 Ga0209588_1000395 Ga0209588_100039512 267
135 3300027671 Ga0209588_1067422 Ga0209588_10674221 267
136 3300035118 Ga0373954_0000438 Ga0373954_0000438_12713_13537 267
137 3300035118 Ga0373954_0037071 Ga0373954_0037071_677_1510 267
138 3300035119 Ga0373956_0002308 Ga0373956_0002308_2047_2871 267
139 3300035695 Ga0373927_0000237 Ga0373927_0000237_27960_28784 267
140 3300036401 Ga0373937_0595846 Ga0373937_0595846_88_912 267
141 3300037853 Ga0436364_0449524 Ga0436364_0449524_1908_2720 267
142 3300044673 Ga0453683_0004448 Ga0453683_0004448_4139_4957 267
143 3300044684 Ga0466966_0060684 Ga0466966_0060684_1348_2169 267
144 3300044693 Ga0466961_0005502 Ga0466961_0005502_4283_5104 267
145 3300044712 Ga0453684_0122673 Ga0453684_0122673_2010_2828 267
146 3300044765 Ga0466970_0089144 Ga0466970_0089144_555_1376 267
147 3300044842 Ga0466957_0001647 Ga0466957_0001647_2907_3728 267
148 3300045049 Ga0466959_0019511 Ga0466959_0019511_3568_4389 267
149 3300045836 Ga0466958_0004480 Ga0466958_0004480_2492_3313 267
150 3300046455 Ga0495603_0177147 Ga0495603_0177147_210_1049 267
151 3300046517 Ga0495630_0297337 Ga0495630_0297337_138_977 267
152 3300046533 Ga0495640_0064109 Ga0495640_0064109_1467_2306 267
153 3300050514 nmdc:mga08x19_20014_c1 nmdc:mga08x19_20014_c1_40_888 267
154 3300061719 Ga0466962_0012780 Ga0466962_0012780_1363_2184 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

68

166

0.97

PF13649

Methyltransf_25

Methyltransferase domain

67

162

0.95

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

50

186

0.9

PF08242

Methyltransf_12

Methyltransferase domain

68

164

0.9

PF13847

Methyltransf_31

Methyltransferase domain

61

227

0.89

PF13489

Methyltransf_23

Methyltransferase domain

48

226

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bus-assembly2.cif.gz_B crystal structure of rebm 0.8742 39 267
5bxy-assembly2.cif.gz_B crystal structure of rna methyltransferase from salinibacter ruber in complex with s-adenosyl-l-homocysteine 0.8558 34 157
3ha7-assembly1.cif.gz_A crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosyl-n-decyl-aminoethyl (sadae) 0.8499 40 266
1l1e-assembly1.cif.gz_A crystal structure of mycolic acid cyclopropane synthase pcaa complexed with s-adenosyl-l-homocysteine 0.8423 39 266
2o57-assembly2.cif.gz_C crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria 0.8411 37 266
ID Description Score Start End Superfamily
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9309 39 165 3.40.50.150
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9297 41 206 3.40.50.150
af_O69696_536_776_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9217 30 267 3.40.50.150
af_O69696_536_776_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9069 30 267 3.40.50.150
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9005 9 195 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3N1CP95-F1-model_v4 Methyltransferase family protein 0.9175 38 204 GO:0008168
GO:0032259
AF-A0A151F5I2-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9127 24 266 GO:0008757
AF-A0A231NXQ1-F1-model_v4 Methyltransferase type 11 0.905 16 207 GO:0008757
GO:0032259
AF-A0A7C7VC89-F1-model_v4 deleted 0.8966 41 157
AF-A0A2E7SH57-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.8781 22 267 GO:0008757

Feature Viewer

pLDDT pTM Quality
89.68 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map