F218317

General Info

Members Datasets Scaffolds Average Seq Length
153 130 306 376

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675902999|2676204537
Length 402
Sequence TEDLPAEDLTAQDRPAGGRRAIGRRGVIAGMAAAPVLVAASASAASATSAASVTGAGSGGGQGKPQRPTTLVIGHRGASGYRPEHTLASYELAARLGADFVEPDLVVTKDGHLVCRHEPEIGGTTNVADHPEFAARRVTKTLDGVSLTGWFTEDFTLAELKTLRAKERIPDVRQHNTLYNGRFEIPTLIEVLDLRKRLSAELGRQIGVYPETKHPTYFQKAGLALEKRLLDTLNRYGLNDKNAPVFXQSFETKNLGELXRLGLRTRAVQLLSAAGAPFDLIDAGDKRTYADLITPAGLKTIATYANGIGPDKNQIIPRDAAGNLGTPTTLVADAHKAGLVLHPYTFRAENSFLPADYRVGTVASDYGRAIDEQVTFLRTGIDGLFTDNTDVGILARAAFLGG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
5 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
6 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
7 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
8 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
9 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
10 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
11 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
12 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
17 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
18 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
19 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
20 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
21 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
22 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
23 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
24 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
25 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
26 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
27 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
28 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
29 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
30 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
31 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
32 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
33 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
34 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
35 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
36 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
37 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
42 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
43 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
44 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
45 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
46 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
47 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
48 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
49 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
50 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
51 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
52 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
53 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
54 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
55 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
56 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
57 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
58 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
59 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
62 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
63 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
64 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
65 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
66 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
67 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
68 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
85 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
86 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
87 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
88 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
89 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
90 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
91 2508501039 Frankia saprophytica CN3 Isolate Nodule
92 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
93 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
94 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
95 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
96 2619618881 Frankia sp. ACN1ag Isolate Unclassified
97 2619619003 Frankia sp. CpI1-P Isolate Nodule
98 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
99 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
100 2643221647 Streptomyces sp. Root369 Isolate Unclassified
101 2643221714 Streptomyces sp. Root264 Isolate Unclassified
102 2687453737 Frankia sp. BMG5.36 Isolate Nodule
103 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
104 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
105 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
106 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
107 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
108 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
109 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
110 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
111 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
112 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
113 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
114 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
115 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
116 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
117 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
118 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
119 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
120 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
121 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
122 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
123 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
124 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
125 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
126 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
127 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
128 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
129 8002775197 Frankia nepalensis CN7 Isolate Nodule
130 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.2
Metatranscriptomes 0
Isolates 26.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.27
Nodule 5.23
Rhizoplane 7.84
Rhizosphere 65.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10087518 3300005937 Bacteria 2534
2 Ga0081540_1002450 3300005983 Bacteria 15109
3 Ga0081539_10020795 3300005985 Bacteria 4415
4 Ga0075428_100133637 3300006844 Bacteria 2698
5 Ga0075431_100093242 3300006847 Bacteria 3108
6 Ga0075429_100204685 3300006880 Bacteria 1729
7 Ga0163163_10063134 3300014325 Bacteria 3672
8 Ga0163163_10138945 3300014325 Bacteria 2471
9 Ga0182006_1044452 3300015261 Bacteria 1732
10 Ga0182007_10003750 3300015262 Bacteria 7093
11 Ga0183367_1010 3300015688 Bacteria 416164
12 Ga0213875_10001112 3300021388 Bacteria 18652
13 Ga0207647_10017347 3300025904 Bacteria 4894
14 Ga0207639_10194049 3300026041 Bacteria 1736
15 Ga0207641_10482124 3300026088 Bacteria 1202
16 Ga0207676_10050040 3300026095 Bacteria 3255
17 Ga0307515_10002303 3300028794 Bacteria 41725
18 Ga0307515_10077309 3300028794 Bacteria 4398
19 Ga0307515_10109623 3300028794 Bacteria 3240
20 Ga0307512_10002775 3300030522 Bacteria 21342
21 Ga0307513_10000936 3300031456 Bacteria 42211
22 Ga0307513_10015236 3300031456 Bacteria 9331
23 Ga0307513_10193300 3300031456 Bacteria 1884
24 Ga0307508_10011333 3300031616 Bacteria 8151
25 Ga0307516_10014993 3300031730 Bacteria 8172
26 Ga0307516_10072213 3300031730 Bacteria 3311
27 Ga0307516_10079879 3300031730 Bacteria 3115
28 Ga0307405_10204787 3300031731 Bacteria 1436
29 Ga0307413_10152408 3300031824 Bacteria 1613
30 Ga0307406_10134801 3300031901 Bacteria 1739
31 Ga0307416_100247918 3300032002 Bacteria 1731
32 Ga0307415_100034356 3300032126 Bacteria 3301
33 Ga0436364_0849153 3300037853 Bacteria 48156
34 Ga0436365_1624654 3300039437 Bacteria 5901
35 Ga0439449_0000979 3300042007 Bacteria 11230
36 Ga0439455_0009522 3300042012 Bacteria 2111
37 Ga0450903_000167 3300042138 Bacteria 14392
38 Ga0439458_0000431 3300042157 Bacteria 10563
39 Ga0466972_0047615 3300044658 Bacteria 2073
40 Ga0466965_0000384 3300044683 Bacteria 15113
41 Ga0466966_0002972 3300044684 Bacteria 11159
42 Ga0466961_0000223 3300044693 Bacteria 38608
43 Ga0466961_0162167 3300044693 Bacteria 1393
44 Ga0466963_0000604 3300044694 Bacteria 17169
45 Ga0466964_0004239 3300044706 Bacteria 5280
46 Ga0466971_0000354 3300044719 Bacteria 17531
47 Ga0466970_0001357 3300044765 Bacteria 11799
48 Ga0466957_0001214 3300044842 Bacteria 13432
49 Ga0466960_0036697 3300044901 Bacteria 2296
50 Ga0466959_0002684 3300045049 Bacteria 11425
51 Ga0466967_0001120 3300045976 Bacteria 14881
52 Ga0466967_0001549 3300045976 Bacteria 13465
53 Ga0495592_0022626 3300046454 Bacteria 4781
54 Ga0495603_0001172 3300046455 Bacteria 15279
55 Ga0495603_0020588 3300046455 Bacteria 3996
56 Ga0495629_0001247 3300046459 Bacteria 19989
57 Ga0495639_0152741 3300046475 Bacteria 1114
58 Ga0495630_0215134 3300046517 Bacteria 1467
59 Ga0495640_0001365 3300046533 Bacteria 19217
60 Ga0495622_0107508 3300046557 Bacteria 1278
61 Ga0495588_0017033 3300046674 Bacteria 3521
62 Ga0495657_0032651 3300046675 Bacteria 3631
63 Ga0495657_0048267 3300046675 Bacteria 2873
64 Ga0495613_0000756 3300046689 Bacteria 25323
65 Ga0495613_0009073 3300046689 Bacteria 7377
66 Ga0495600_0062482 3300046809 Bacteria 2433
67 Ga0495600_0134345 3300046809 Bacteria 1607
68 Ga0495604_0080922 3300047317 Bacteria 2433
69 Ga0495604_0191462 3300047317 Bacteria 1425
70 Ga0495636_0012442 3300047318 Bacteria 3369
71 Ga0495676_0000233 3300047321 Bacteria 44485
72 Ga0495685_003809 3300047447 Bacteria 4829
73 Ga0495685_008548 3300047447 Bacteria 3402
74 Ga0495614_0031789 3300048089 Bacteria 2272
75 Ga0496101_0064101 3300048904 Bacteria 2676
76 Ga0496103_0009177 3300048906 Bacteria 5857
77 Ga0496104_0064068 3300048907 Bacteria 3487
78 Ga0496105_0185186 3300048908 Bacteria 1704
79 Ga0496108_0253073 3300048911 Bacteria 1532
80 Ga0496109_0078436 3300048912 Bacteria 3041
81 Ga0496109_0202092 3300048912 Bacteria 1868
82 Ga0496110_0227115 3300048913 Bacteria 1698
83 Ga0496112_0211425 3300048915 Bacteria 1897
84 Ga0496113_0042556 3300048916 Bacteria 3357
85 Ga0496114_0016006 3300048917 Bacteria 6035
86 Ga0496114_0036355 3300048917 Bacteria 4071
87 Ga0501032_0011745 3300049569 Bacteria 6280
88 Ga0501033_0001859 3300049570 Bacteria 18350
89 Ga0501033_0003701 3300049570 Bacteria 12434
90 Ga0501034_0106586 3300049571 Bacteria 2795
91 Ga0501036_0009350 3300049572 Bacteria 8060
92 Ga0501036_0055100 3300049572 Bacteria 3368
93 Ga0501038_0033124 3300049574 Bacteria 4552
94 Ga0501038_0105837 3300049574 Bacteria 2336
95 Ga0501039_0015926 3300049575 Bacteria 5757
96 Ga0501043_0025046 3300049579 Bacteria 4681
97 Ga0501047_0025169 3300049581 Bacteria 5719
98 Ga0501047_0171653 3300049581 Bacteria 2037
99 Ga0501069_0075092 3300049585 Bacteria 1898
100 Ga0501070_0000925 3300049586 Bacteria 26486
101 Ga0501074_0002652 3300049590 Bacteria 12537
102 Ga0501035_0003186 3300049822 Bacteria 15726
103 Ga0501035_0059688 3300049822 Bacteria 3397
104 Ga0501044_0063809 3300049823 Bacteria 3761
105 nmdc:mga06r32_126838_c2 3300050510 Bacteria 2010
106 Ga0500646_0002486 3300053090 Bacteria 4791
107 Ga0500583_0109780 3300053092 Bacteria 1358
108 Ga0500641_0065915 3300053096 Bacteria 1516
109 Ga0500588_0001624 3300053146 Bacteria 4341
110 Ga0500600_0114720 3300053149 Bacteria 1399
111 Ga0466962_0000302 3300061719 Bacteria 21145
112 Ga0466962_0050087 3300061719 Bacteria 1996
113 2676204537 2675902999 Bacteria 9438463
114 2508676684 2508501039 Bacteria 9978592
115 2579855230 2579778521 Bacteria 7624758
116 2585303620 2582581313 Bacteria 10042643
117 2585321069 2582581314 Bacteria 11452267
118 2616695697 2616644814 Bacteria 11555299
119 2619855165 2619618881 Bacteria 7521104
120 2620351400 2619619003 Bacteria 7619552
121 2643853255 2643221567 Bacteria 4163945
122 2644137218 2643221624 Bacteria 4384879
123 2644268092 2643221647 Bacteria 10741251
124 2644629691 2643221714 Bacteria 9015452
125 2689960607 2687453737 Bacteria 11203906
126 2689994259 2687453743 Bacteria 8361025
127 2774849112 2773857921 Bacteria 9435764
128 2785367224 2784746768 Bacteria 10036182
129 2786668271 2786546132 Bacteria 10419719
130 2808918464 2808606375 Bacteria 9466072
131 2862289591 2862281513 Bacteria 9621493
132 2862510481 2862507626 Bacteria 9425308
133 2877683323 2877676314 Bacteria 9512378
134 2912722335 2912715099 Bacteria 9460473
135 2946073997 2946072368 Bacteria 8999607
136 2947231760 2947224130 Bacteria 9938529
137 2954011007 2954002825 Bacteria 9173742
138 2954388570 2954380949 Bacteria 10050426
139 2954674555 2954673503 Bacteria 9685905
140 2954689577 2954682443 Bacteria 9862841
141 2954699359 2954691527 Bacteria 10720516
142 2954702860 2954701450 Bacteria 10834262
143 2954718301 2954711539 Bacteria 10867210
144 2954728271 2954721474 Bacteria 10456478
145 2954733539 2954731030 Bacteria 10243860
146 2954747165 2954740390 Bacteria 10229294
147 2954752422 2954749733 Bacteria 10366972
148 3001891705 3001889506 Bacteria 2975194
149 3006327933 3006321560 Bacteria 8247479
150 3006397657 3006393351 Bacteria 6615579
151 3006497767 3006493962 Bacteria 8825450
152 8002779788 8002775197 Bacteria 10728764
153 8054916430 8054913762 Bacteria 7713009
154 Ga0081455_10087518
155 Ga0081540_1002450
156 Ga0081539_10020795
157 Ga0075428_100133637
158 Ga0075431_100093242
159 Ga0075429_100204685
160 Ga0163163_10063134
161 Ga0163163_10138945
162 Ga0182006_1044452
163 Ga0182007_10003750
164 Ga0183367_1010
165 Ga0213875_10001112
166 Ga0207647_10017347
167 Ga0207639_10194049
168 Ga0207641_10482124
169 Ga0207676_10050040
170 Ga0307515_10002303
171 Ga0307515_10077309
172 Ga0307515_10109623
173 Ga0307512_10002775
174 Ga0307513_10000936
175 Ga0307513_10015236
176 Ga0307513_10193300
177 Ga0307508_10011333
178 Ga0307516_10014993
179 Ga0307516_10072213
180 Ga0307516_10079879
181 Ga0307405_10204787
182 Ga0307413_10152408
183 Ga0307406_10134801
184 Ga0307416_100247918
185 Ga0307415_100034356
186 Ga0436364_0849153
187 Ga0436365_1624654
188 Ga0439449_0000979
189 Ga0439455_0009522
190 Ga0450903_000167
191 Ga0439458_0000431
192 Ga0466972_0047615
193 Ga0466965_0000384
194 Ga0466966_0002972
195 Ga0466961_0000223
196 Ga0466961_0162167
197 Ga0466963_0000604
198 Ga0466964_0004239
199 Ga0466971_0000354
200 Ga0466970_0001357
201 Ga0466957_0001214
202 Ga0466960_0036697
203 Ga0466959_0002684
204 Ga0466967_0001120
205 Ga0466967_0001549
206 Ga0495592_0022626
207 Ga0495603_0001172
208 Ga0495603_0020588
209 Ga0495629_0001247
210 Ga0495639_0152741
211 Ga0495630_0215134
212 Ga0495640_0001365
213 Ga0495622_0107508
214 Ga0495588_0017033
215 Ga0495657_0032651
216 Ga0495657_0048267
217 Ga0495613_0000756
218 Ga0495613_0009073
219 Ga0495600_0062482
220 Ga0495600_0134345
221 Ga0495604_0080922
222 Ga0495604_0191462
223 Ga0495636_0012442
224 Ga0495676_0000233
225 Ga0495685_003809
226 Ga0495685_008548
227 Ga0495614_0031789
228 Ga0496101_0064101
229 Ga0496103_0009177
230 Ga0496104_0064068
231 Ga0496105_0185186
232 Ga0496108_0253073
233 Ga0496109_0078436
234 Ga0496109_0202092
235 Ga0496110_0227115
236 Ga0496112_0211425
237 Ga0496113_0042556
238 Ga0496114_0016006
239 Ga0496114_0036355
240 Ga0501032_0011745
241 Ga0501033_0001859
242 Ga0501033_0003701
243 Ga0501034_0106586
244 Ga0501036_0009350
245 Ga0501036_0055100
246 Ga0501038_0033124
247 Ga0501038_0105837
248 Ga0501039_0015926
249 Ga0501043_0025046
250 Ga0501047_0025169
251 Ga0501047_0171653
252 Ga0501069_0075092
253 Ga0501070_0000925
254 Ga0501074_0002652
255 Ga0501035_0003186
256 Ga0501035_0059688
257 Ga0501044_0063809
258 nmdc:mga06r32_126838_c2
259 Ga0500646_0002486
260 Ga0500583_0109780
261 Ga0500641_0065915
262 Ga0500588_0001624
263 Ga0500600_0114720
264 Ga0466962_0000302
265 Ga0466962_0050087
266 2676204537
267 2508676684
268 2579855230
269 2585303620
270 2585321069
271 2616695697
272 2619855165
273 2620351400
274 2643853255
275 2644137218
276 2644268092
277 2644629691
278 2689960607
279 2689994259
280 2774849112
281 2785367224
282 2786668271
283 2808918464
284 2862289591
285 2862510481
286 2877683323
287 2912722335
288 2946073997
289 2947231760
290 2954011007
291 2954388570
292 2954674555
293 2954689577
294 2954699359
295 2954702860
296 2954718301
297 2954728271
298 2954733539
299 2954747165
300 2954752422
301 3001891705
302 3006327933
303 3006397657
304 3006497767
305 8002779788
306 8054916430

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

75

391

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ks5-assembly1.cif.gz_A crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 2.05 a resolution 0.7857 39 319
2p76-assembly2.cif.gz_B crystal structure of a glycerophosphodiester phosphodiesterase from staphylococcus aureus 0.7822 39 279
1t8q-assembly1.cif.gz_D structural genomics, crystal structure of glycerophosphoryl diester phosphodiesterase from e. coli 0.7778 39 323
8cwp-assembly1.cif.gz_A-2 x-ray crystal structure of nthi protein d bound to a putative glycerol moiety 0.7658 39 319
1o1z-assembly1.cif.gz_A crystal structure of glycerophosphodiester phosphodiesterase (gdpd) (tm1621) from thermotoga maritima at 1.60 a resolution 0.758 39 279
ID Description Score Start End Superfamily
af_Q9SD81_43_361_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.843 41 319 3.20.20.190
4oecB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8356 39 279 3.20.20.190
af_I1KYF2_42_344_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8267 39 319 3.20.20.190
af_Q9FJ62_365_668_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8074 39 319 3.20.20.190
af_P9WMU3_1_270_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8072 38 279 3.20.20.190
ID Description Score Start End GO Terms
AF-A0A357A8F0-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9672 39 279 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A6B3I106-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9577 63 234 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A2N8FM84-F1-model_v4 deleted 0.957 58 160
AF-A0A453FKL6-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.956 65 189 GO:0006071
GO:0006629
GO:0008889
AF-A0A520EPK6-F1-model_v4 deleted 0.9531 35 220

Map