F218317
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 153 | 130 | 306 | 376 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2675902999|2676204537 |
| Length | 402 |
| Sequence | TEDLPAEDLTAQDRPAGGRRAIGRRGVIAGMAAAPVLVAASASAASATSAASVTGAGSGGGQGKPQRPTTLVIGHRGASGYRPEHTLASYELAARLGADFVEPDLVVTKDGHLVCRHEPEIGGTTNVADHPEFAARRVTKTLDGVSLTGWFTEDFTLAELKTLRAKERIPDVRQHNTLYNGRFEIPTLIEVLDLRKRLSAELGRQIGVYPETKHPTYFQKAGLALEKRLLDTLNRYGLNDKNAPVFXQSFETKNLGELXRLGLRTRAVQLLSAAGAPFDLIDAGDKRTYADLITPAGLKTIATYANGIGPDKNQIIPRDAAGNLGTPTTLVADAHKAGLVLHPYTFRAENSFLPADYRVGTVASDYGRAIDEQVTFLRTGIDGLFTDNTDVGILARAAFLGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 5 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 6 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 7 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 8 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 9 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 10 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 11 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 12 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 13 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 17 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 18 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 19 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 20 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 21 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 22 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 23 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 24 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 25 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 26 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 27 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 28 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 29 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 30 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 31 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 32 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 33 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 34 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 35 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 36 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 37 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 38 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 39 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 40 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 41 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 42 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 43 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 44 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 61 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 62 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 63 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 64 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 65 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 66 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 67 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 68 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 69 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 70 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 74 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 75 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 76 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 77 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 78 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 79 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 80 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 82 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 83 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 84 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 85 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 86 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 87 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 88 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 89 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 90 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 91 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 92 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 93 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 94 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 95 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 96 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 97 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 98 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 99 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 100 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 101 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 102 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 103 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 104 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 105 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 106 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 107 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 108 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 109 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 110 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 111 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 112 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 113 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 114 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 115 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 116 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 117 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 118 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 119 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 120 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 121 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 122 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 123 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 124 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 125 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 126 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 127 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 128 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 129 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 130 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.2 |
| Metatranscriptomes | 0 |
| Isolates | 26.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.27 |
| Nodule | 5.23 |
| Rhizoplane | 7.84 |
| Rhizosphere | 65.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10087518 | 3300005937 | Bacteria | 2534 |
| 2 | Ga0081540_1002450 | 3300005983 | Bacteria | 15109 |
| 3 | Ga0081539_10020795 | 3300005985 | Bacteria | 4415 |
| 4 | Ga0075428_100133637 | 3300006844 | Bacteria | 2698 |
| 5 | Ga0075431_100093242 | 3300006847 | Bacteria | 3108 |
| 6 | Ga0075429_100204685 | 3300006880 | Bacteria | 1729 |
| 7 | Ga0163163_10063134 | 3300014325 | Bacteria | 3672 |
| 8 | Ga0163163_10138945 | 3300014325 | Bacteria | 2471 |
| 9 | Ga0182006_1044452 | 3300015261 | Bacteria | 1732 |
| 10 | Ga0182007_10003750 | 3300015262 | Bacteria | 7093 |
| 11 | Ga0183367_1010 | 3300015688 | Bacteria | 416164 |
| 12 | Ga0213875_10001112 | 3300021388 | Bacteria | 18652 |
| 13 | Ga0207647_10017347 | 3300025904 | Bacteria | 4894 |
| 14 | Ga0207639_10194049 | 3300026041 | Bacteria | 1736 |
| 15 | Ga0207641_10482124 | 3300026088 | Bacteria | 1202 |
| 16 | Ga0207676_10050040 | 3300026095 | Bacteria | 3255 |
| 17 | Ga0307515_10002303 | 3300028794 | Bacteria | 41725 |
| 18 | Ga0307515_10077309 | 3300028794 | Bacteria | 4398 |
| 19 | Ga0307515_10109623 | 3300028794 | Bacteria | 3240 |
| 20 | Ga0307512_10002775 | 3300030522 | Bacteria | 21342 |
| 21 | Ga0307513_10000936 | 3300031456 | Bacteria | 42211 |
| 22 | Ga0307513_10015236 | 3300031456 | Bacteria | 9331 |
| 23 | Ga0307513_10193300 | 3300031456 | Bacteria | 1884 |
| 24 | Ga0307508_10011333 | 3300031616 | Bacteria | 8151 |
| 25 | Ga0307516_10014993 | 3300031730 | Bacteria | 8172 |
| 26 | Ga0307516_10072213 | 3300031730 | Bacteria | 3311 |
| 27 | Ga0307516_10079879 | 3300031730 | Bacteria | 3115 |
| 28 | Ga0307405_10204787 | 3300031731 | Bacteria | 1436 |
| 29 | Ga0307413_10152408 | 3300031824 | Bacteria | 1613 |
| 30 | Ga0307406_10134801 | 3300031901 | Bacteria | 1739 |
| 31 | Ga0307416_100247918 | 3300032002 | Bacteria | 1731 |
| 32 | Ga0307415_100034356 | 3300032126 | Bacteria | 3301 |
| 33 | Ga0436364_0849153 | 3300037853 | Bacteria | 48156 |
| 34 | Ga0436365_1624654 | 3300039437 | Bacteria | 5901 |
| 35 | Ga0439449_0000979 | 3300042007 | Bacteria | 11230 |
| 36 | Ga0439455_0009522 | 3300042012 | Bacteria | 2111 |
| 37 | Ga0450903_000167 | 3300042138 | Bacteria | 14392 |
| 38 | Ga0439458_0000431 | 3300042157 | Bacteria | 10563 |
| 39 | Ga0466972_0047615 | 3300044658 | Bacteria | 2073 |
| 40 | Ga0466965_0000384 | 3300044683 | Bacteria | 15113 |
| 41 | Ga0466966_0002972 | 3300044684 | Bacteria | 11159 |
| 42 | Ga0466961_0000223 | 3300044693 | Bacteria | 38608 |
| 43 | Ga0466961_0162167 | 3300044693 | Bacteria | 1393 |
| 44 | Ga0466963_0000604 | 3300044694 | Bacteria | 17169 |
| 45 | Ga0466964_0004239 | 3300044706 | Bacteria | 5280 |
| 46 | Ga0466971_0000354 | 3300044719 | Bacteria | 17531 |
| 47 | Ga0466970_0001357 | 3300044765 | Bacteria | 11799 |
| 48 | Ga0466957_0001214 | 3300044842 | Bacteria | 13432 |
| 49 | Ga0466960_0036697 | 3300044901 | Bacteria | 2296 |
| 50 | Ga0466959_0002684 | 3300045049 | Bacteria | 11425 |
| 51 | Ga0466967_0001120 | 3300045976 | Bacteria | 14881 |
| 52 | Ga0466967_0001549 | 3300045976 | Bacteria | 13465 |
| 53 | Ga0495592_0022626 | 3300046454 | Bacteria | 4781 |
| 54 | Ga0495603_0001172 | 3300046455 | Bacteria | 15279 |
| 55 | Ga0495603_0020588 | 3300046455 | Bacteria | 3996 |
| 56 | Ga0495629_0001247 | 3300046459 | Bacteria | 19989 |
| 57 | Ga0495639_0152741 | 3300046475 | Bacteria | 1114 |
| 58 | Ga0495630_0215134 | 3300046517 | Bacteria | 1467 |
| 59 | Ga0495640_0001365 | 3300046533 | Bacteria | 19217 |
| 60 | Ga0495622_0107508 | 3300046557 | Bacteria | 1278 |
| 61 | Ga0495588_0017033 | 3300046674 | Bacteria | 3521 |
| 62 | Ga0495657_0032651 | 3300046675 | Bacteria | 3631 |
| 63 | Ga0495657_0048267 | 3300046675 | Bacteria | 2873 |
| 64 | Ga0495613_0000756 | 3300046689 | Bacteria | 25323 |
| 65 | Ga0495613_0009073 | 3300046689 | Bacteria | 7377 |
| 66 | Ga0495600_0062482 | 3300046809 | Bacteria | 2433 |
| 67 | Ga0495600_0134345 | 3300046809 | Bacteria | 1607 |
| 68 | Ga0495604_0080922 | 3300047317 | Bacteria | 2433 |
| 69 | Ga0495604_0191462 | 3300047317 | Bacteria | 1425 |
| 70 | Ga0495636_0012442 | 3300047318 | Bacteria | 3369 |
| 71 | Ga0495676_0000233 | 3300047321 | Bacteria | 44485 |
| 72 | Ga0495685_003809 | 3300047447 | Bacteria | 4829 |
| 73 | Ga0495685_008548 | 3300047447 | Bacteria | 3402 |
| 74 | Ga0495614_0031789 | 3300048089 | Bacteria | 2272 |
| 75 | Ga0496101_0064101 | 3300048904 | Bacteria | 2676 |
| 76 | Ga0496103_0009177 | 3300048906 | Bacteria | 5857 |
| 77 | Ga0496104_0064068 | 3300048907 | Bacteria | 3487 |
| 78 | Ga0496105_0185186 | 3300048908 | Bacteria | 1704 |
| 79 | Ga0496108_0253073 | 3300048911 | Bacteria | 1532 |
| 80 | Ga0496109_0078436 | 3300048912 | Bacteria | 3041 |
| 81 | Ga0496109_0202092 | 3300048912 | Bacteria | 1868 |
| 82 | Ga0496110_0227115 | 3300048913 | Bacteria | 1698 |
| 83 | Ga0496112_0211425 | 3300048915 | Bacteria | 1897 |
| 84 | Ga0496113_0042556 | 3300048916 | Bacteria | 3357 |
| 85 | Ga0496114_0016006 | 3300048917 | Bacteria | 6035 |
| 86 | Ga0496114_0036355 | 3300048917 | Bacteria | 4071 |
| 87 | Ga0501032_0011745 | 3300049569 | Bacteria | 6280 |
| 88 | Ga0501033_0001859 | 3300049570 | Bacteria | 18350 |
| 89 | Ga0501033_0003701 | 3300049570 | Bacteria | 12434 |
| 90 | Ga0501034_0106586 | 3300049571 | Bacteria | 2795 |
| 91 | Ga0501036_0009350 | 3300049572 | Bacteria | 8060 |
| 92 | Ga0501036_0055100 | 3300049572 | Bacteria | 3368 |
| 93 | Ga0501038_0033124 | 3300049574 | Bacteria | 4552 |
| 94 | Ga0501038_0105837 | 3300049574 | Bacteria | 2336 |
| 95 | Ga0501039_0015926 | 3300049575 | Bacteria | 5757 |
| 96 | Ga0501043_0025046 | 3300049579 | Bacteria | 4681 |
| 97 | Ga0501047_0025169 | 3300049581 | Bacteria | 5719 |
| 98 | Ga0501047_0171653 | 3300049581 | Bacteria | 2037 |
| 99 | Ga0501069_0075092 | 3300049585 | Bacteria | 1898 |
| 100 | Ga0501070_0000925 | 3300049586 | Bacteria | 26486 |
| 101 | Ga0501074_0002652 | 3300049590 | Bacteria | 12537 |
| 102 | Ga0501035_0003186 | 3300049822 | Bacteria | 15726 |
| 103 | Ga0501035_0059688 | 3300049822 | Bacteria | 3397 |
| 104 | Ga0501044_0063809 | 3300049823 | Bacteria | 3761 |
| 105 | nmdc:mga06r32_126838_c2 | 3300050510 | Bacteria | 2010 |
| 106 | Ga0500646_0002486 | 3300053090 | Bacteria | 4791 |
| 107 | Ga0500583_0109780 | 3300053092 | Bacteria | 1358 |
| 108 | Ga0500641_0065915 | 3300053096 | Bacteria | 1516 |
| 109 | Ga0500588_0001624 | 3300053146 | Bacteria | 4341 |
| 110 | Ga0500600_0114720 | 3300053149 | Bacteria | 1399 |
| 111 | Ga0466962_0000302 | 3300061719 | Bacteria | 21145 |
| 112 | Ga0466962_0050087 | 3300061719 | Bacteria | 1996 |
| 113 | 2676204537 | 2675902999 | Bacteria | 9438463 |
| 114 | 2508676684 | 2508501039 | Bacteria | 9978592 |
| 115 | 2579855230 | 2579778521 | Bacteria | 7624758 |
| 116 | 2585303620 | 2582581313 | Bacteria | 10042643 |
| 117 | 2585321069 | 2582581314 | Bacteria | 11452267 |
| 118 | 2616695697 | 2616644814 | Bacteria | 11555299 |
| 119 | 2619855165 | 2619618881 | Bacteria | 7521104 |
| 120 | 2620351400 | 2619619003 | Bacteria | 7619552 |
| 121 | 2643853255 | 2643221567 | Bacteria | 4163945 |
| 122 | 2644137218 | 2643221624 | Bacteria | 4384879 |
| 123 | 2644268092 | 2643221647 | Bacteria | 10741251 |
| 124 | 2644629691 | 2643221714 | Bacteria | 9015452 |
| 125 | 2689960607 | 2687453737 | Bacteria | 11203906 |
| 126 | 2689994259 | 2687453743 | Bacteria | 8361025 |
| 127 | 2774849112 | 2773857921 | Bacteria | 9435764 |
| 128 | 2785367224 | 2784746768 | Bacteria | 10036182 |
| 129 | 2786668271 | 2786546132 | Bacteria | 10419719 |
| 130 | 2808918464 | 2808606375 | Bacteria | 9466072 |
| 131 | 2862289591 | 2862281513 | Bacteria | 9621493 |
| 132 | 2862510481 | 2862507626 | Bacteria | 9425308 |
| 133 | 2877683323 | 2877676314 | Bacteria | 9512378 |
| 134 | 2912722335 | 2912715099 | Bacteria | 9460473 |
| 135 | 2946073997 | 2946072368 | Bacteria | 8999607 |
| 136 | 2947231760 | 2947224130 | Bacteria | 9938529 |
| 137 | 2954011007 | 2954002825 | Bacteria | 9173742 |
| 138 | 2954388570 | 2954380949 | Bacteria | 10050426 |
| 139 | 2954674555 | 2954673503 | Bacteria | 9685905 |
| 140 | 2954689577 | 2954682443 | Bacteria | 9862841 |
| 141 | 2954699359 | 2954691527 | Bacteria | 10720516 |
| 142 | 2954702860 | 2954701450 | Bacteria | 10834262 |
| 143 | 2954718301 | 2954711539 | Bacteria | 10867210 |
| 144 | 2954728271 | 2954721474 | Bacteria | 10456478 |
| 145 | 2954733539 | 2954731030 | Bacteria | 10243860 |
| 146 | 2954747165 | 2954740390 | Bacteria | 10229294 |
| 147 | 2954752422 | 2954749733 | Bacteria | 10366972 |
| 148 | 3001891705 | 3001889506 | Bacteria | 2975194 |
| 149 | 3006327933 | 3006321560 | Bacteria | 8247479 |
| 150 | 3006397657 | 3006393351 | Bacteria | 6615579 |
| 151 | 3006497767 | 3006493962 | Bacteria | 8825450 |
| 152 | 8002779788 | 8002775197 | Bacteria | 10728764 |
| 153 | 8054916430 | 8054913762 | Bacteria | 7713009 |
| 154 | Ga0081455_10087518 | |||
| 155 | Ga0081540_1002450 | |||
| 156 | Ga0081539_10020795 | |||
| 157 | Ga0075428_100133637 | |||
| 158 | Ga0075431_100093242 | |||
| 159 | Ga0075429_100204685 | |||
| 160 | Ga0163163_10063134 | |||
| 161 | Ga0163163_10138945 | |||
| 162 | Ga0182006_1044452 | |||
| 163 | Ga0182007_10003750 | |||
| 164 | Ga0183367_1010 | |||
| 165 | Ga0213875_10001112 | |||
| 166 | Ga0207647_10017347 | |||
| 167 | Ga0207639_10194049 | |||
| 168 | Ga0207641_10482124 | |||
| 169 | Ga0207676_10050040 | |||
| 170 | Ga0307515_10002303 | |||
| 171 | Ga0307515_10077309 | |||
| 172 | Ga0307515_10109623 | |||
| 173 | Ga0307512_10002775 | |||
| 174 | Ga0307513_10000936 | |||
| 175 | Ga0307513_10015236 | |||
| 176 | Ga0307513_10193300 | |||
| 177 | Ga0307508_10011333 | |||
| 178 | Ga0307516_10014993 | |||
| 179 | Ga0307516_10072213 | |||
| 180 | Ga0307516_10079879 | |||
| 181 | Ga0307405_10204787 | |||
| 182 | Ga0307413_10152408 | |||
| 183 | Ga0307406_10134801 | |||
| 184 | Ga0307416_100247918 | |||
| 185 | Ga0307415_100034356 | |||
| 186 | Ga0436364_0849153 | |||
| 187 | Ga0436365_1624654 | |||
| 188 | Ga0439449_0000979 | |||
| 189 | Ga0439455_0009522 | |||
| 190 | Ga0450903_000167 | |||
| 191 | Ga0439458_0000431 | |||
| 192 | Ga0466972_0047615 | |||
| 193 | Ga0466965_0000384 | |||
| 194 | Ga0466966_0002972 | |||
| 195 | Ga0466961_0000223 | |||
| 196 | Ga0466961_0162167 | |||
| 197 | Ga0466963_0000604 | |||
| 198 | Ga0466964_0004239 | |||
| 199 | Ga0466971_0000354 | |||
| 200 | Ga0466970_0001357 | |||
| 201 | Ga0466957_0001214 | |||
| 202 | Ga0466960_0036697 | |||
| 203 | Ga0466959_0002684 | |||
| 204 | Ga0466967_0001120 | |||
| 205 | Ga0466967_0001549 | |||
| 206 | Ga0495592_0022626 | |||
| 207 | Ga0495603_0001172 | |||
| 208 | Ga0495603_0020588 | |||
| 209 | Ga0495629_0001247 | |||
| 210 | Ga0495639_0152741 | |||
| 211 | Ga0495630_0215134 | |||
| 212 | Ga0495640_0001365 | |||
| 213 | Ga0495622_0107508 | |||
| 214 | Ga0495588_0017033 | |||
| 215 | Ga0495657_0032651 | |||
| 216 | Ga0495657_0048267 | |||
| 217 | Ga0495613_0000756 | |||
| 218 | Ga0495613_0009073 | |||
| 219 | Ga0495600_0062482 | |||
| 220 | Ga0495600_0134345 | |||
| 221 | Ga0495604_0080922 | |||
| 222 | Ga0495604_0191462 | |||
| 223 | Ga0495636_0012442 | |||
| 224 | Ga0495676_0000233 | |||
| 225 | Ga0495685_003809 | |||
| 226 | Ga0495685_008548 | |||
| 227 | Ga0495614_0031789 | |||
| 228 | Ga0496101_0064101 | |||
| 229 | Ga0496103_0009177 | |||
| 230 | Ga0496104_0064068 | |||
| 231 | Ga0496105_0185186 | |||
| 232 | Ga0496108_0253073 | |||
| 233 | Ga0496109_0078436 | |||
| 234 | Ga0496109_0202092 | |||
| 235 | Ga0496110_0227115 | |||
| 236 | Ga0496112_0211425 | |||
| 237 | Ga0496113_0042556 | |||
| 238 | Ga0496114_0016006 | |||
| 239 | Ga0496114_0036355 | |||
| 240 | Ga0501032_0011745 | |||
| 241 | Ga0501033_0001859 | |||
| 242 | Ga0501033_0003701 | |||
| 243 | Ga0501034_0106586 | |||
| 244 | Ga0501036_0009350 | |||
| 245 | Ga0501036_0055100 | |||
| 246 | Ga0501038_0033124 | |||
| 247 | Ga0501038_0105837 | |||
| 248 | Ga0501039_0015926 | |||
| 249 | Ga0501043_0025046 | |||
| 250 | Ga0501047_0025169 | |||
| 251 | Ga0501047_0171653 | |||
| 252 | Ga0501069_0075092 | |||
| 253 | Ga0501070_0000925 | |||
| 254 | Ga0501074_0002652 | |||
| 255 | Ga0501035_0003186 | |||
| 256 | Ga0501035_0059688 | |||
| 257 | Ga0501044_0063809 | |||
| 258 | nmdc:mga06r32_126838_c2 | |||
| 259 | Ga0500646_0002486 | |||
| 260 | Ga0500583_0109780 | |||
| 261 | Ga0500641_0065915 | |||
| 262 | Ga0500588_0001624 | |||
| 263 | Ga0500600_0114720 | |||
| 264 | Ga0466962_0000302 | |||
| 265 | Ga0466962_0050087 | |||
| 266 | 2676204537 | |||
| 267 | 2508676684 | |||
| 268 | 2579855230 | |||
| 269 | 2585303620 | |||
| 270 | 2585321069 | |||
| 271 | 2616695697 | |||
| 272 | 2619855165 | |||
| 273 | 2620351400 | |||
| 274 | 2643853255 | |||
| 275 | 2644137218 | |||
| 276 | 2644268092 | |||
| 277 | 2644629691 | |||
| 278 | 2689960607 | |||
| 279 | 2689994259 | |||
| 280 | 2774849112 | |||
| 281 | 2785367224 | |||
| 282 | 2786668271 | |||
| 283 | 2808918464 | |||
| 284 | 2862289591 | |||
| 285 | 2862510481 | |||
| 286 | 2877683323 | |||
| 287 | 2912722335 | |||
| 288 | 2946073997 | |||
| 289 | 2947231760 | |||
| 290 | 2954011007 | |||
| 291 | 2954388570 | |||
| 292 | 2954674555 | |||
| 293 | 2954689577 | |||
| 294 | 2954699359 | |||
| 295 | 2954702860 | |||
| 296 | 2954718301 | |||
| 297 | 2954728271 | |||
| 298 | 2954733539 | |||
| 299 | 2954747165 | |||
| 300 | 2954752422 | |||
| 301 | 3001891705 | |||
| 302 | 3006327933 | |||
| 303 | 3006397657 | |||
| 304 | 3006497767 | |||
| 305 | 8002779788 | |||
| 306 | 8054916430 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ks5-assembly1.cif.gz_A | crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 2.05 a resolution | 0.7857 | 39 | 319 |
| 2p76-assembly2.cif.gz_B | crystal structure of a glycerophosphodiester phosphodiesterase from staphylococcus aureus | 0.7822 | 39 | 279 |
| 1t8q-assembly1.cif.gz_D | structural genomics, crystal structure of glycerophosphoryl diester phosphodiesterase from e. coli | 0.7778 | 39 | 323 |
| 8cwp-assembly1.cif.gz_A-2 | x-ray crystal structure of nthi protein d bound to a putative glycerol moiety | 0.7658 | 39 | 319 |
| 1o1z-assembly1.cif.gz_A | crystal structure of glycerophosphodiester phosphodiesterase (gdpd) (tm1621) from thermotoga maritima at 1.60 a resolution | 0.758 | 39 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SD81_43_361_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.843 | 41 | 319 | 3.20.20.190 |
| 4oecB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8356 | 39 | 279 | 3.20.20.190 |
| af_I1KYF2_42_344_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8267 | 39 | 319 | 3.20.20.190 |
| af_Q9FJ62_365_668_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8074 | 39 | 319 | 3.20.20.190 |
| af_P9WMU3_1_270_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8072 | 38 | 279 | 3.20.20.190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357A8F0-F1-model_v4 | glycerophosphodiester phosphodiesterase (EC 3.1.4.46) | 0.9672 | 39 | 279 |
GO:0006071
GO:0006629 GO:0008889 GO:0042597 |
| AF-A0A6B3I106-F1-model_v4 | glycerophosphodiester phosphodiesterase (EC 3.1.4.46) | 0.9577 | 63 | 234 |
GO:0006071
GO:0006629 GO:0008889 GO:0042597 |
| AF-A0A2N8FM84-F1-model_v4 | deleted | 0.957 | 58 | 160 |
|
| AF-A0A453FKL6-F1-model_v4 | glycerophosphodiester phosphodiesterase (EC 3.1.4.46) | 0.956 | 65 | 189 |
GO:0006071
GO:0006629 GO:0008889 |
| AF-A0A520EPK6-F1-model_v4 | deleted | 0.9531 | 35 | 220 |
|