F217443

General Info

Members Datasets Scaffolds Average Seq Length
153 120 306 254

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100038743|Ga0307416_1000387433
Length 293
Sequence LAADRRRERRDSNCRLIIRIRGISVHLRLVFAFLVLDPMFDLSGKISLVTGAASGIGEAAAHALAAAGAFVYVADIDEGNGSRVAEEIVNEGGQSEFIRLNVADQTECERVAENVQANRGRLDILVNNAGVGHVGTIRETTAADLDRLFAVNVRGMFNLTKAFIEGMIERQFGVVINTSSIGGILAIRERLAYCTTKFAVVGFTKCLALDHARQGIRANAICPGRVETPFVKARLAEYPDPQKAYEEMSATQAIGRMATPEEIAASVLYLASDEAAFITGTALEIDGGWSTGK

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
116 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 2718218365 Rhizobium sp. N731 Isolate Nodule
119 2728369397 Rhizobium sp. N1314 Isolate Nodule
120 2842747753 Variovorax sp. R-72060 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 1.31
Rhizoplane 1.31
Rhizosphere 89.54
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100038743 3300032002 Bacteria 3680
2 rootL2_10106784 3300003322 Bacteria 3042
3 rootL2_10170750 3300003322 Bacteria 2425
4 Ga0065704_10106265 3300005289 Bacteria 2088
5 Ga0070658_10003609 3300005327 Bacteria 12681
6 Ga0070670_100047082 3300005331 Bacteria 3710
7 Ga0070670_100110424 3300005331 Bacteria 2369
8 Ga0070689_100003449 3300005340 Bacteria 10517
9 Ga0070675_100101255 3300005354 Unclassified 2427
10 Ga0070671_100309680 3300005355 Bacteria 1345
11 Ga0070674_100220212 3300005356 Bacteria 1476
12 Ga0070673_100364168 3300005364 Unclassified 1286
13 Ga0070673_100619516 3300005364 Bacteria 988
14 Ga0070688_100126706 3300005365 Bacteria 1717
15 Ga0070708_100356874 3300005445 Bacteria 1378
16 Ga0068867_100745675 3300005459 Bacteria 868
17 Ga0070706_100003808 3300005467 Bacteria 14735
18 Ga0070706_100004194 3300005467 Bacteria 13996
19 Ga0070707_100008398 3300005468 Bacteria 9589
20 Ga0070698_100028307 3300005471 Bacteria 5822
21 Ga0070699_100042512 3300005518 Bacteria 3933
22 Ga0070697_100411440 3300005536 Bacteria 1174
23 Ga0070672_100174510 3300005543 Bacteria 1789
24 Ga0070665_100304731 3300005548 Bacteria 1596
25 Ga0068852_100163192 3300005616 Bacteria 2082
26 Ga0068864_100304165 3300005618 Bacteria 1494
27 Ga0068870_10311023 3300005840 Bacteria 998
28 Ga0068863_100122568 3300005841 Bacteria 2479
29 Ga0068862_100247113 3300005844 Bacteria 1625
30 Ga0070712_100172382 3300006175 Bacteria 1680
31 Ga0075428_100658329 3300006844 Bacteria 1117
32 Ga0075433_10029977 3300006852 Bacteria 4638
33 Ga0075434_100493070 3300006871 Bacteria 1246
34 Ga0075429_100052265 3300006880 Bacteria 3555
35 Ga0099795_10064568 3300007788 Bacteria 1367
36 Ga0105240_10120876 3300009093 Bacteria 3154
37 Ga0114129_10003106 3300009147 Bacteria 23287
38 Ga0114129_10114040 3300009147 Bacteria 3726
39 Ga0105241_10071370 3300009174 Bacteria 2696
40 Ga0105248_10161279 3300009177 Bacteria 2529
41 Ga0105237_10597017 3300009545 Bacteria 1111
42 Ga0105249_10015090 3300009553 Bacteria 6833
43 Ga0105249_10070691 3300009553 Bacteria 3222
44 Ga0105239_10668303 3300010375 Bacteria 1187
45 Ga0163162_10119914 3300013306 Bacteria 2734
46 Ga0163163_10199751 3300014325 Bacteria 2048
47 Ga0157380_10086251 3300014326 Bacteria 2579
48 Ga0157380_10467345 3300014326 Bacteria 1216
49 Ga0163161_10045542 3300017792 Bacteria 3164
50 Ga0209258_101203 3300025242 Bacteria 10244
51 Ga0209026_1001241 3300025250 Bacteria 11674
52 Ga0209257_1002339 3300025304 Bacteria 19082
53 Ga0207682_10127020 3300025893 Bacteria 1136
54 Ga0207643_10102097 3300025908 Unclassified 1682
55 Ga0207705_10006536 3300025909 Bacteria 8634
56 Ga0207684_10004500 3300025910 Bacteria 13106
57 Ga0207671_10386726 3300025914 Bacteria 1112
58 Ga0207660_10148531 3300025917 Bacteria 1799
59 Ga0207662_10206544 3300025918 Bacteria 1273
60 Ga0207646_10004389 3300025922 Bacteria 15343
61 Ga0207681_10221178 3300025923 Bacteria 1465
62 Ga0207650_10216460 3300025925 Bacteria 1540
63 Ga0207650_10271153 3300025925 Bacteria 1379
64 Ga0207644_10103019 3300025931 Bacteria 2148
65 Ga0207709_10416126 3300025935 Bacteria 1031
66 Ga0207670_10003165 3300025936 Bacteria 8712
67 Ga0207691_10348379 3300025940 Bacteria 1267
68 Ga0207711_10154674 3300025941 Bacteria 2072
69 Ga0207639_10255498 3300026041 Bacteria 1530
70 Ga0207678_10452400 3300026067 Bacteria 1116
71 Ga0207648_10686504 3300026089 Bacteria 948
72 Ga0207676_10063207 3300026095 Bacteria 2939
73 Ga0207676_10302709 3300026095 Bacteria 1460
74 Ga0207674_10377566 3300026116 Bacteria 1370
75 Ga0207428_10241475 3300027907 Bacteria 1349
76 Ga0268265_10133802 3300028380 Unclassified 2065
77 Ga0307512_10011662 3300030522 Bacteria 8316
78 Ga0265327_10044238 3300031251 Bacteria 2376
79 Ga0307405_10008628 3300031731 Bacteria 5179
80 Ga0307405_10015793 3300031731 Bacteria 4099
81 Ga0307405_10071319 3300031731 Bacteria 2235
82 Ga0307413_10003254 3300031824 Bacteria 6804
83 Ga0307410_10004380 3300031852 Bacteria 7291
84 Ga0307410_10006952 3300031852 Bacteria 6153
85 Ga0307410_10136658 3300031852 Bacteria 1808
86 Ga0307410_10263417 3300031852 Bacteria 1345
87 Ga0307406_10283751 3300031901 Bacteria 1264
88 Ga0307406_10285068 3300031901 Bacteria 1262
89 Ga0307407_10139004 3300031903 Bacteria 1565
90 Ga0307407_10139507 3300031903 Bacteria 1562
91 Ga0307412_10126190 3300031911 Bacteria 1851
92 Ga0307409_100001547 3300031995 Bacteria 11413
93 Ga0307409_100298338 3300031995 Bacteria 1498
94 Ga0307409_100640720 3300031995 Bacteria 1055
95 Ga0307416_100185689 3300032002 Bacteria 1954
96 Ga0307416_100452060 3300032002 Bacteria 1337
97 Ga0307414_10314157 3300032004 Bacteria 1331
98 Ga0307411_10023756 3300032005 Bacteria 3639
99 Ga0307415_100008488 3300032126 Bacteria 5699
100 Ga0373927_0151887 3300035695 Bacteria 1516
101 Ga0395899_0000017 3300037312 Bacteria 440179
102 Ga0400483_061895 3300039062 Bacteria 3229
103 Ga0451853_0627135 3300041512 Bacteria 2220
104 Ga0451853_2857008 3300041512 Bacteria 1329
105 Ga0466963_0022408 3300044694 Bacteria 4001
106 Ga0495653_0080204 3300046463 Bacteria 2415
107 Ga0495662_0335858 3300046476 Bacteria 743
108 Ga0495608_0044674 3300046511 Bacteria 2956
109 Ga0495608_0205970 3300046511 Bacteria 1238
110 Ga0495618_0042293 3300046514 Bacteria 2872
111 Ga0495618_0527956 3300046514 Bacteria 709
112 Ga0495628_0009379 3300046516 Bacteria 8353
113 Ga0495628_0016446 3300046516 Bacteria 6171
114 Ga0495630_0061897 3300046517 Bacteria 2811
115 Ga0495630_0117223 3300046517 Bacteria 2018
116 Ga0495640_0006828 3300046533 Bacteria 8995
117 Ga0495586_0198864 3300046535 Bacteria 1136
118 Ga0495586_0259561 3300046535 Bacteria 992
119 Ga0495645_0171014 3300046543 Bacteria 1496
120 Ga0495645_0415304 3300046543 Bacteria 855
121 Ga0495667_0112291 3300046559 Bacteria 1761
122 Ga0495634_0183236 3300046642 Bacteria 1310
123 Ga0495625_0000911 3300046660 Bacteria 39772
124 Ga0495657_0155893 3300046675 Bacteria 1415
125 Ga0495599_0182490 3300046678 Bacteria 1293
126 Ga0495658_0004214 3300046683 Bacteria 7075
127 Ga0495613_0175594 3300046689 Bacteria 1519
128 Ga0495624_0089310 3300046690 Bacteria 1902
129 Ga0495604_0068631 3300047317 Bacteria 2690
130 Ga0495674_0156990 3300047319 Bacteria 1905
131 Ga0495674_0166265 3300047319 Bacteria 1843
132 Ga0496114_0586244 3300048917 Unclassified 984
133 Ga0496115_0004992 3300048918 Bacteria 9635
134 Ga0495678_075190 3300049459 Bacteria 1227
135 Ga0501076_0407128 3300049592 Bacteria 1119
136 nmdc:mga09592_86818_c1 3300050508 Bacteria 2670
137 nmdc:mga08y16_554407_c1 3300050511 Bacteria 1163
138 nmdc:mga0n895_149236_c1 3300050512 Bacteria 2367
139 nmdc:mga0n895_752027_c1 3300050512 Bacteria 968
140 nmdc:mga0a205_591392_c1 3300050515 Bacteria 963
141 Ga0495601_0021635 3300053077 Bacteria 3940
142 Ga0495601_0235717 3300053077 Bacteria 1195
143 Ga0495595_0017035 3300053084 Bacteria 3120
144 Ga0495595_0180392 3300053084 Bacteria 1047
145 Ga0495619_0008043 3300053085 Bacteria 6674
146 Ga0495619_0076521 3300053085 Unclassified 2247
147 Ga0495619_0221333 3300053085 Bacteria 1311
148 Ga0500646_0017082 3300053090 Bacteria 1899
149 Ga0500647_0007314 3300053091 Bacteria 4736
150 Ga0501082_0139057 3300060353 Bacteria 2108
151 2721158312 2718218365 Bacteria 6274507
152 2730297944 2728369397 Bacteria 6274511
153 2842751304 2842747753 Bacteria 5578255
154 Ga0307416_100038743
155 rootL2_10106784
156 rootL2_10170750
157 Ga0065704_10106265
158 Ga0070658_10003609
159 Ga0070670_100047082
160 Ga0070670_100110424
161 Ga0070689_100003449
162 Ga0070675_100101255
163 Ga0070671_100309680
164 Ga0070674_100220212
165 Ga0070673_100364168
166 Ga0070673_100619516
167 Ga0070688_100126706
168 Ga0070708_100356874
169 Ga0068867_100745675
170 Ga0070706_100003808
171 Ga0070706_100004194
172 Ga0070707_100008398
173 Ga0070698_100028307
174 Ga0070699_100042512
175 Ga0070697_100411440
176 Ga0070672_100174510
177 Ga0070665_100304731
178 Ga0068852_100163192
179 Ga0068864_100304165
180 Ga0068870_10311023
181 Ga0068863_100122568
182 Ga0068862_100247113
183 Ga0070712_100172382
184 Ga0075428_100658329
185 Ga0075433_10029977
186 Ga0075434_100493070
187 Ga0075429_100052265
188 Ga0099795_10064568
189 Ga0105240_10120876
190 Ga0114129_10003106
191 Ga0114129_10114040
192 Ga0105241_10071370
193 Ga0105248_10161279
194 Ga0105237_10597017
195 Ga0105249_10015090
196 Ga0105249_10070691
197 Ga0105239_10668303
198 Ga0163162_10119914
199 Ga0163163_10199751
200 Ga0157380_10086251
201 Ga0157380_10467345
202 Ga0163161_10045542
203 Ga0209258_101203
204 Ga0209026_1001241
205 Ga0209257_1002339
206 Ga0207682_10127020
207 Ga0207643_10102097
208 Ga0207705_10006536
209 Ga0207684_10004500
210 Ga0207671_10386726
211 Ga0207660_10148531
212 Ga0207662_10206544
213 Ga0207646_10004389
214 Ga0207681_10221178
215 Ga0207650_10216460
216 Ga0207650_10271153
217 Ga0207644_10103019
218 Ga0207709_10416126
219 Ga0207670_10003165
220 Ga0207691_10348379
221 Ga0207711_10154674
222 Ga0207639_10255498
223 Ga0207678_10452400
224 Ga0207648_10686504
225 Ga0207676_10063207
226 Ga0207676_10302709
227 Ga0207674_10377566
228 Ga0207428_10241475
229 Ga0268265_10133802
230 Ga0307512_10011662
231 Ga0265327_10044238
232 Ga0307405_10008628
233 Ga0307405_10015793
234 Ga0307405_10071319
235 Ga0307413_10003254
236 Ga0307410_10004380
237 Ga0307410_10006952
238 Ga0307410_10136658
239 Ga0307410_10263417
240 Ga0307406_10283751
241 Ga0307406_10285068
242 Ga0307407_10139004
243 Ga0307407_10139507
244 Ga0307412_10126190
245 Ga0307409_100001547
246 Ga0307409_100298338
247 Ga0307409_100640720
248 Ga0307416_100185689
249 Ga0307416_100452060
250 Ga0307414_10314157
251 Ga0307411_10023756
252 Ga0307415_100008488
253 Ga0373927_0151887
254 Ga0395899_0000017
255 Ga0400483_061895
256 Ga0451853_0627135
257 Ga0451853_2857008
258 Ga0466963_0022408
259 Ga0495653_0080204
260 Ga0495662_0335858
261 Ga0495608_0044674
262 Ga0495608_0205970
263 Ga0495618_0042293
264 Ga0495618_0527956
265 Ga0495628_0009379
266 Ga0495628_0016446
267 Ga0495630_0061897
268 Ga0495630_0117223
269 Ga0495640_0006828
270 Ga0495586_0198864
271 Ga0495586_0259561
272 Ga0495645_0171014
273 Ga0495645_0415304
274 Ga0495667_0112291
275 Ga0495634_0183236
276 Ga0495625_0000911
277 Ga0495657_0155893
278 Ga0495599_0182490
279 Ga0495658_0004214
280 Ga0495613_0175594
281 Ga0495624_0089310
282 Ga0495604_0068631
283 Ga0495674_0156990
284 Ga0495674_0166265
285 Ga0496114_0586244
286 Ga0496115_0004992
287 Ga0495678_075190
288 Ga0501076_0407128
289 nmdc:mga09592_86818_c1
290 nmdc:mga08y16_554407_c1
291 nmdc:mga0n895_149236_c1
292 nmdc:mga0n895_752027_c1
293 nmdc:mga0a205_591392_c1
294 Ga0495601_0021635
295 Ga0495601_0235717
296 Ga0495595_0017035
297 Ga0495595_0180392
298 Ga0495619_0008043
299 Ga0495619_0076521
300 Ga0495619_0221333
301 Ga0500646_0017082
302 Ga0500647_0007314
303 Ga0501082_0139057
304 2721158312
305 2730297944
306 2842751304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

45

239

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

290

0.95

PF08659

KR

KR domain

46

227

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

190

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xew-assembly1.cif.gz_A structure of serratia marcescens 2,3-butanediol dehydrogenase 0.9825 13 264
2cfc-assembly1.cif.gz_D structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases 0.9772 17 257
6xew-assembly1.cif.gz_A structure of serratia marcescens 2,3-butanediol dehydrogenase 0.9748 13 264
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.974 13 253
6vsp-assembly1.cif.gz_B structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a 0.9721 11 263
ID Description Score Start End Superfamily
2cfcD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9772 17 257 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9709 10 253 3.40.50.720
5t5qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9674 14 254 3.40.50.720
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 14 257 3.40.50.720
1nfrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9633 12 260 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M2W7I8-F1-model_v4 deleted 0.9914 96 264
AF-A0A8B3MZ94-F1-model_v4 deleted 0.9909 76 264
AF-A0A062TY16-F1-model_v4 Uncharacterized protein 0.9906 17 262 GO:0016491
AF-A0A1H4I8P8-F1-model_v4 Meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase 0.9905 12 264 GO:0016491
AF-A0A4Q3HIX3-F1-model_v4 deleted 0.9896 12 263

Map