F217266

General Info

Members Datasets Scaffolds Average Seq Length
153 125 121 209

Family's Representative Sequence

Representative Sequence 3300028666|Ga0265336_10002574|Ga0265336_100025743
Length 234
Sequence LYFQTLCDRKVAEGFFRPSVSFLGSGMNNDLNWRYATKKFDSSKKISKKDFAELLEVLRFSPSSYGLQPWKFVIVHDPVLRKKLRPHAWGQPQVTDADSLIVFCALKTMDDDYVNRYVDLIAQVRGVTKESLLSYEQMMMASLKDKSPEAVSQWMKNQVYIALGIFLSECAHRKIDACPMEGFDPHKFDEILKLPQEGLESVVLCAIGYRALDDNYAQQKKVRFDKNKVFIDRS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
7 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
8 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
9 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
10 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
11 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
12 2818991444 Filimonas endophytica 3197 Isolate Unclassified
13 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
14 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
15 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
16 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
17 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
18 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
19 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
20 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
21 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
22 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
23 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
24 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
25 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
26 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
27 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
28 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
29 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
55 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
92 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
102 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
103 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
112 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
113 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
114 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
115 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
118 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
119 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
120 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
121 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
122 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
123 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
124 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
125 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.93
Metatranscriptomes 8.5
Isolates 21.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 3.27
Rhizoplane 0.65
Rhizosphere 74.51
Stem 0
Stem Tuber 0
Unclassified 17.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214736902 2209111006 Bacteria 989
2 rootH1_10194063 3300003316 Bacteria 1401
3 rootH1_10194063 3300003323 Bacteria 3669
4 Ga0007409J51694_1029223 3300003575 Bacteria 1714
5 Ga0006562J51391_1006169 3300003578 Bacteria 1801
6 Ga0065714_10100808 3300005288 Bacteria 1656
7 Ga0065715_10277827 3300005293 Bacteria 1094
8 Ga0070682_100185582 3300005337 Bacteria 1456
9 Ga0070689_100199965 3300005340 Bacteria 1631
10 Ga0068865_100890566 3300006881 Bacteria 773
11 Ga0075436_100032623 3300006914 Bacteria 3590
12 Ga0099824_1006255 3300006942 Bacteria 16424
13 Ga0079104_1000178 3300006946 Bacteria 90393
14 Ga0099826_10004816 3300006948 Bacteria 9537
15 Ga0105244_10000002 3300009036 Bacteria 495554
16 Ga0105240_10000639 3300009093 Bacteria 64584
17 Ga0157373_10000001 3300013100 Bacteria 864756
18 Ga0157371_10014362 3300013102 Bacteria 5979
19 Ga0157370_10000261 3300013104 Bacteria 66927
20 Ga0157370_10000393 3300013104 Bacteria 54961
21 Ga0157370_10002210 3300013104 Bacteria 23756
22 Ga0157370_10014878 3300013104 Bacteria 7938
23 Ga0157370_10099036 3300013104 Bacteria 2732
24 Ga0157369_10004820 3300013105 Bacteria 15839
25 Ga0157375_10000460 3300013308 Bacteria 37011
26 Ga0182006_1045046 3300015261 Bacteria 1718
27 Ga0163161_10000015 3300017792 Bacteria 250785
28 Ga0163161_10031053 3300017792 Bacteria 3804
29 Ga0163161_10205963 3300017792 Bacteria 1518
30 Ga0207655_1000012 3300025728 Bacteria 640488
31 Ga0207695_10000591 3300025913 Bacteria 73179
32 Ga0207670_10226084 3300025936 Bacteria 1435
33 Ga0209281_1000299 3300027111 Bacteria 90106
34 Ga0209489_113867 3300027361 Bacteria 6129
35 Ga0265336_10002574 3300028666 Bacteria 7413
36 Ga0265338_10002345 3300028800 Bacteria 28610
37 Ga0265338_10042041 3300028800 Bacteria 4264
38 Ga0265338_10053305 3300028800 Bacteria 3620
39 Ga0265338_10094734 3300028800 Bacteria 2455
40 Ga0316179_1065575 3300030734 Bacteria 1439
41 Ga0265331_10041768 3300031250 Bacteria 2227
42 Ga0307408_100007375 3300031548 Bacteria 7280
43 Ga0316576_10027533 3300031727 Bacteria 3998
44 Ga0307405_10042470 3300031731 Bacteria 2768
45 Ga0307413_10000106 3300031824 Bacteria 21433
46 Ga0307413_10094510 3300031824 Bacteria 1957
47 Ga0307410_10003701 3300031852 Bacteria 7735
48 Ga0307406_10000055 3300031901 Bacteria 62544
49 Ga0307407_10000130 3300031903 Bacteria 23045
50 Ga0307416_100001143 3300032002 Bacteria 14243
51 Ga0307414_10000012 3300032004 Bacteria 322675
52 Ga0307414_10023873 3300032004 Bacteria 3887
53 Ga0307414_10036268 3300032004 Bacteria 3290
54 Ga0307414_10036536 3300032004 Bacteria 3280
55 Ga0307414_10081669 3300032004 Bacteria 2367
56 Ga0307411_10000008 3300032005 Bacteria 321575
57 Ga0307510_10096430 3300033180 Bacteria 2773
58 Ga0373932_0066445 3300035112 Bacteria 1108
59 Ga0316574_0055743 3300035398 Bacteria 2471
60 Ga0395905_0251126 3300037471 Unclassified 1652
61 Ga0439447_002463 3300041407 Bacteria 6736
62 Ga0439466_0124397 3300041411 Bacteria 795
63 Ga0451577_1084660 3300042876 Bacteria 717
64 Ga0453684_0000030 3300044712 Bacteria 752725
65 Ga0451576_0000062 3300045051 Bacteria 284262
66 Ga0451576_0000441 3300045051 Bacteria 94687
67 Ga0451576_0636034 3300045051 Bacteria 1121
68 Ga0495627_003552 3300046453 Bacteria 6812
69 Ga0495605_0058281 3300046474 Bacteria 1857
70 Ga0495596_0009353 3300046500 Bacteria 4310
71 Ga0495596_0032659 3300046500 Bacteria 2074
72 Ga0495583_0004787 3300046506 Bacteria 9494
73 Ga0495606_0005651 3300046507 Bacteria 11852
74 Ga0495606_0072651 3300046507 Bacteria 2160
75 Ga0495610_0120283 3300046512 Bacteria 1152
76 Ga0495610_0184891 3300046512 Bacteria 864
77 Ga0495616_0000150 3300046513 Bacteria 60876
78 Ga0495631_0000337 3300046518 Bacteria 32281
79 Ga0495632_0000012 3300046519 Bacteria 264389
80 Ga0495644_0005585 3300046523 Bacteria 4907
81 Ga0495644_0014841 3300046523 Bacteria 2983
82 Ga0495661_0004301 3300046665 Bacteria 10331
83 Ga0495661_0021909 3300046665 Bacteria 4159
84 Ga0495671_0194586 3300046692 Bacteria 984
85 Ga0495672_0000109 3300047320 Bacteria 131335
86 Ga0495681_0003061 3300047470 Bacteria 11731
87 Ga0496115_0054001 3300048918 Bacteria 3226
88 Ga0496116_0000004 3300048919 Bacteria 839841
89 Ga0496118_0019650 3300048921 Bacteria 6030
90 Ga0496121_0049936 3300048924 Bacteria 3540
91 Ga0496121_0229294 3300048924 Bacteria 1302
92 Ga0496124_0092361 3300048927 Bacteria 2465
93 Ga0496125_0000012 3300048928 Bacteria 651142
94 Ga0496125_0000483 3300048928 Bacteria 70302
95 Ga0496126_0033952 3300048929 Bacteria 4798
96 Ga0496126_0170465 3300048929 Bacteria 1854
97 Ga0501310_002718 3300049130 Bacteria 1693
98 Ga0495678_000060 3300049459 Bacteria 142851
99 Ga0495682_0000035 3300049460 Bacteria 126349
100 Ga0501314_001402 3300049530 Bacteria 1743
101 Ga0501319_000522 3300049535 Bacteria 1873
102 Ga0501320_002076 3300049536 Bacteria 1567
103 Ga0501320_003773 3300049536 Bacteria 1303
104 Ga0501323_007253 3300049539 Bacteria 1261
105 Ga0501323_007426 3300049539 Bacteria 1252
106 Ga0501324_001062 3300049540 Bacteria 1736
107 Ga0501325_002036 3300049541 Bacteria 1336
108 Ga0501326_00646 3300049542 Bacteria 1439
109 Ga0501334_01081 3300049550 Bacteria 1441
110 Ga0501238_000214 3300049671 Bacteria 8338
111 Ga0501249_000027 3300049679 Bacteria 87387
112 Ga0501241_018672 3300049758 Bacteria 1271
113 Ga0501266_000004 3300049763 Bacteria 356286
114 Ga0501280_002156 3300049776 Bacteria 3381
115 nmdc:mga08x19_26180_c1 3300050514 Bacteria 3638
116 Ga0500641_0000025 3300053096 Bacteria 108050
117 Ga0500641_0000242 3300053096 Bacteria 20695
118 Ga0500641_0000553 3300053096 Bacteria 13499
119 Ga0500594_0101766 3300053118 Bacteria 885
120 Ga0500658_0000010 3300053134 Bacteria 248149
121 Ga0500584_002431 3300053726 Bacteria 7042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_1084660 Ga0451577_1084660_63_671 201
2 3300006914 Ga0075436_100032623 Ga0075436_1000326235 203
3 3300046500 Ga0495596_0009353 Ga0495596_0009353_1158_1769 203
4 3300046500 Ga0495596_0032659 Ga0495596_0032659_1393_2004 203
5 3300046506 Ga0495583_0004787 Ga0495583_0004787_7789_8400 203
6 3300046507 Ga0495606_0072651 Ga0495606_0072651_803_1414 203
7 3300046513 Ga0495616_0000150 Ga0495616_0000150_27314_27925 203
8 3300046518 Ga0495631_0000337 Ga0495631_0000337_31436_32047 203
9 3300046523 Ga0495644_0014841 Ga0495644_0014841_284_895 203
10 3300047470 Ga0495681_0003061 Ga0495681_0003061_5824_6435 203
11 3300049459 Ga0495678_000060 Ga0495678_000060_85371_85982 203
12 3300049460 Ga0495682_0000035 Ga0495682_0000035_91807_92418 203
13 3300050514 nmdc:mga08x19_26180_c1 nmdc:mga08x19_26180_c1_1742_2353 203
14 3300028800 Ga0265338_10002345 Ga0265338_1000234516 205
15 iso_pu_bacteria 2818991444 2819587288 205
16 iso_pu_bacteria 2833640130 2833643843 205
17 iso_pu_bacteria 2852623160 2852626610 205
18 iso_pu_bacteria 2884933994 2884935040 205
19 iso_pu_bacteria 2977232053 2977234585 205
20 3300047320 Ga0495672_0000109 Ga0495672_0000109_103616_104236 206
21 iso_pu_bacteria 2513020052 2513232247 206
22 iso_pu_bacteria 2519899754 2520881923 206
23 iso_pu_bacteria 2643221600 2644009831 206
24 iso_pu_bacteria 2643221667 2644374211 206
25 iso_pu_bacteria 2643221725 2644683688 206
26 iso_pu_bacteria 2738541279 2738733224 206
27 iso_pu_bacteria 2738541285 2738765762 206
28 iso_pu_bacteria 2738543007 2739214805 206
29 iso_pu_bacteria 2802428842 2802652425 206
30 iso_pu_bacteria 2816332280 2817417392 206
31 iso_pu_bacteria 2857613821 2857615902 206
32 iso_pu_bacteria 2857618242 2857620352 206
33 iso_pu_bacteria 2881359912 2881362671 206
34 iso_pu_bacteria 2903895155 2903897874 206
35 iso_pu_bacteria 2904419702 2904422095 206
36 iso_pu_bacteria 2904474040 2904477025 206
37 iso_pu_bacteria 2904555929 2904559067 206
38 iso_pu_bacteria 2919191525 2919192094 206
39 iso_pu_bacteria 2919683626 2919686053 206
40 iso_pu_bacteria 2929150217 2929154656 206
41 iso_pu_bacteria 2958458903 2958459104 206
42 iso_pu_bacteria 2965320100 2965323330 206
43 iso_pu_bacteria 2977268062 2977271491 206
44 iso_pu_bacteria 8054307821 8054310556 206
45 iso_pu_bacteria 8055419101 8055423017 206
46 iso_pu_bacteria 8055592153 8055596632 206
47 iso_pu_bacteria 8056440228 8056442044 206
48 3300028800 Ga0265338_10053305 Ga0265338_100533053 207
49 3300045051 Ga0451576_0000062 Ga0451576_0000062_31382_32008 207
50 3300006881 Ga0068865_100890566 Ga0068865_1008905661 209
51 3300028800 Ga0265338_10042041 Ga0265338_100420417 209
52 3300032004 Ga0307414_10023873 Ga0307414_100238732 209
53 3300035112 Ga0373932_0066445 Ga0373932_0066445_117_773 209
54 3300044712 Ga0453684_0000030 Ga0453684_0000030_461980_462612 209
55 3300046474 Ga0495605_0058281 Ga0495605_0058281_156_785 209
56 3300046519 Ga0495632_0000012 Ga0495632_0000012_165652_166281 209
57 3300046523 Ga0495644_0005585 Ga0495644_0005585_2259_2888 209
58 3300046665 Ga0495661_0004301 Ga0495661_0004301_2925_3554 209
59 3300046665 Ga0495661_0021909 Ga0495661_0021909_1133_1762 209
60 iso_pu_bacteria 8015556637 8015558068 209
61 2209111006 2214736902 2213743087 210
62 3300003323 rootH1_10194063 rootH1_101940633 210
63 3300003575 Ga0007409J51694_1029223 Ga0007409J51694_10292232 210
64 3300003578 Ga0006562J51391_1006169 Ga0006562J51391_10061692 210
65 3300005288 Ga0065714_10100808 Ga0065714_101008082 210
66 3300005293 Ga0065715_10277827 Ga0065715_102778272 210
67 3300005337 Ga0070682_100185582 Ga0070682_1001855822 210
68 3300005340 Ga0070689_100199965 Ga0070689_1001999652 210
69 3300006942 Ga0099824_1006255 Ga0099824_10062553 210
70 3300006946 Ga0079104_1000178 Ga0079104_100017829 210
71 3300006948 Ga0099826_10004816 Ga0099826_100048169 210
72 3300009036 Ga0105244_10000002 Ga0105244_10000002413 210
73 3300009093 Ga0105240_10000639 Ga0105240_1000063945 210
74 3300013100 Ga0157373_10000001 Ga0157373_10000001209 210
75 3300013102 Ga0157371_10014362 Ga0157371_100143622 210
76 3300013104 Ga0157370_10000261 Ga0157370_1000026152 210
77 3300013104 Ga0157370_10000393 Ga0157370_1000039345 210
78 3300013104 Ga0157370_10002210 Ga0157370_1000221019 210
79 3300013104 Ga0157370_10014878 Ga0157370_100148784 210
80 3300013104 Ga0157370_10099036 Ga0157370_100990362 210
81 3300013105 Ga0157369_10004820 Ga0157369_100048209 210
82 3300013308 Ga0157375_10000460 Ga0157375_1000046028 210
83 3300015261 Ga0182006_1045046 Ga0182006_10450462 210
84 3300017792 Ga0163161_10000015 Ga0163161_10000015226 210
85 3300017792 Ga0163161_10031053 Ga0163161_100310533 210
86 3300017792 Ga0163161_10205963 Ga0163161_102059632 210
87 3300025728 Ga0207655_1000012 Ga0207655_1000012447 210
88 3300025913 Ga0207695_10000591 Ga0207695_1000059142 210
89 3300025936 Ga0207670_10226084 Ga0207670_102260842 210
90 3300027111 Ga0209281_1000299 Ga0209281_100029928 210
91 3300027361 Ga0209489_113867 Ga0209489_1138676 210
92 3300028666 Ga0265336_10002574 Ga0265336_100025743 210
93 3300028800 Ga0265338_10094734 Ga0265338_100947342 210
94 3300030734 Ga0316179_1065575 Ga0316179_10655751 210
95 3300031250 Ga0265331_10041768 Ga0265331_100417683 210
96 3300031548 Ga0307408_100007375 Ga0307408_1000073754 210
97 3300031727 Ga0316576_10027533 Ga0316576_100275332 210
98 3300031731 Ga0307405_10042470 Ga0307405_100424703 210
99 3300031824 Ga0307413_10000106 Ga0307413_1000010611 210
100 3300031824 Ga0307413_10094510 Ga0307413_100945104 210
101 3300031852 Ga0307410_10003701 Ga0307410_100037018 210
102 3300031901 Ga0307406_10000055 Ga0307406_1000005527 210
103 3300031903 Ga0307407_10000130 Ga0307407_1000013020 210
104 3300032002 Ga0307416_100001143 Ga0307416_10000114314 210
105 3300032004 Ga0307414_10000012 Ga0307414_1000001283 210
106 3300032004 Ga0307414_10036268 Ga0307414_100362683 210
107 3300032004 Ga0307414_10036536 Ga0307414_100365363 210
108 3300032004 Ga0307414_10081669 Ga0307414_100816691 210
109 3300032005 Ga0307411_10000008 Ga0307411_1000000879 210
110 3300033180 Ga0307510_10096430 Ga0307510_100964302 210
111 3300035398 Ga0316574_0055743 Ga0316574_0055743_1348_1992 210
112 3300037471 Ga0395905_0251126 Ga0395905_0251126_156_812 210
113 3300041407 Ga0439447_002463 Ga0439447_002463_4257_4889 210
114 3300041411 Ga0439466_0124397 Ga0439466_0124397_119_751 210
115 3300045051 Ga0451576_0000441 Ga0451576_0000441_7303_7953 210
116 3300045051 Ga0451576_0636034 Ga0451576_0636034_78_728 210
117 3300046453 Ga0495627_003552 Ga0495627_003552_5755_6393 210
118 3300046507 Ga0495606_0005651 Ga0495606_0005651_6215_6853 210
119 3300046512 Ga0495610_0120283 Ga0495610_0120283_38_670 210
120 3300046512 Ga0495610_0184891 Ga0495610_0184891_51_683 210
121 3300046692 Ga0495671_0194586 Ga0495671_0194586_49_681 210
122 3300048918 Ga0496115_0054001 Ga0496115_0054001_565_1203 210
123 3300048919 Ga0496116_0000004 Ga0496116_0000004_209961_210593 210
124 3300048921 Ga0496118_0019650 Ga0496118_0019650_3125_3757 210
125 3300048924 Ga0496121_0049936 Ga0496121_0049936_250_882 210
126 3300048924 Ga0496121_0229294 Ga0496121_0229294_448_1080 210
127 3300048927 Ga0496124_0092361 Ga0496124_0092361_512_1144 210
128 3300048928 Ga0496125_0000012 Ga0496125_0000012_211349_211981 210
129 3300048928 Ga0496125_0000483 Ga0496125_0000483_39202_39840 210
130 3300048929 Ga0496126_0033952 Ga0496126_0033952_1354_1986 210
131 3300048929 Ga0496126_0170465 Ga0496126_0170465_360_992 210
132 3300049130 Ga0501310_002718 Ga0501310_002718_476_1108 210
133 3300049530 Ga0501314_001402 Ga0501314_001402_477_1109 210
134 3300049535 Ga0501319_000522 Ga0501319_000522_763_1401 210
135 3300049536 Ga0501320_002076 Ga0501320_002076_607_1239 210
136 3300049536 Ga0501320_003773 Ga0501320_003773_58_690 210
137 3300049539 Ga0501323_007253 Ga0501323_007253_476_1108 210
138 3300049539 Ga0501323_007426 Ga0501323_007426_466_1098 210
139 3300049540 Ga0501324_001062 Ga0501324_001062_629_1261 210
140 3300049541 Ga0501325_002036 Ga0501325_002036_606_1238 210
141 3300049542 Ga0501326_00646 Ga0501326_00646_179_811 210
142 3300049550 Ga0501334_01081 Ga0501334_01081_613_1245 210
143 3300049671 Ga0501238_000214 Ga0501238_000214_4590_5222 210
144 3300049679 Ga0501249_000027 Ga0501249_000027_42378_43010 210
145 3300049758 Ga0501241_018672 Ga0501241_018672_31_663 210
146 3300049763 Ga0501266_000004 Ga0501266_000004_124039_124671 210
147 3300049776 Ga0501280_002156 Ga0501280_002156_2226_2858 210
148 3300053096 Ga0500641_0000025 Ga0500641_0000025_99549_100181 210
149 3300053096 Ga0500641_0000242 Ga0500641_0000242_15795_16427 210
150 3300053096 Ga0500641_0000553 Ga0500641_0000553_10016_10654 210
151 3300053118 Ga0500594_0101766 Ga0500594_0101766_167_799 210
152 3300053134 Ga0500658_0000010 Ga0500658_0000010_222722_223354 210
153 3300053726 Ga0500584_002431 Ga0500584_002431_1084_1716 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

31

209

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3of4-assembly2.cif.gz_C-2 crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution 0.9551 2 210
3of4-assembly2.cif.gz_C-2 crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution 0.9506 2 210
6czp-assembly1.cif.gz_A 2.2 angstrom resolution crystal structure oxygen-insensitive nad(p)h-dependent nitroreductase nfsb from vibrio vulnificus in complex with fmn 0.9305 3 210
1nec-assembly1.cif.gz_A nitroreductase from enterobacter cloacae 0.9268 4 210
8og3-assembly1.cif.gz_A e. coli nfsb triple mutant t41l/n71s/f124t bound to citrate 0.9211 4 210
ID Description Score Start End Superfamily
3of4C00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9546 4 210 3.40.109.10
3of4C00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9456 4 210 3.40.109.10
1vfrA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9261 1 210 3.40.109.10
1vfrA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9219 1 210 3.40.109.10
3qdlD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8897 5 210 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A7Y2F2V7-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9916 3 210 GO:0016491
AF-A0A4Q6CJA9-F1-model_v4 deleted 0.9915 3 210
AF-L8JPM9-F1-model_v4 Oxygen-insensitive NAD(P)H nitroreductase 0.9911 2 210 GO:0016491
AF-A0A4Q8RVJ6-F1-model_v4 deleted 0.991 1 210
AF-A0A2U2X0F7-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9905 2 210 GO:0016491

Feature Viewer

pLDDT pTM Quality
96.66 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map