F216523

General Info

Members Datasets Scaffolds Average Seq Length
153 85 306 198

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10332298|Ga0068870_103322981
Length 226
Sequence VRTSRLEAFSDGVFAIAATLLVLELRVPPDTTDLVGALLRLWPAYAAYLVSFLTIGIIWVNHHTLLEHCVRVDRRFLYLNLLLLIAVGIVPFPTSLVDQYILSEHDATAALVVYGLGAVLIALAFTGIFLYATHDHRLVGDSAAARRIRAEGRLFPIGLGAYALGIALAFVAPIASLVIYGLTALFYAFPRLPLPKRERGFSAGMSSCSQRRRISSERVSSSSSVP

Samples

Sample ID Description Type Environment
1 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
81 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
82 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
83 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
84 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
85 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 0
Rhizosphere 98.04
Stem 0
Stem Tuber 0
Unclassified 6.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068870_10332298 3300005840 Unclassified 969
2 Ga0065715_10091747 3300005293 Bacteria 5575
3 Ga0070658_10294554 3300005327 Unclassified 1383
4 Ga0070680_100738205 3300005336 Bacteria 847
5 Ga0070692_10001027 3300005345 Bacteria 9617
6 Ga0070673_100196207 3300005364 Bacteria 1736
7 Ga0070667_100604915 3300005367 Unclassified 1010
8 Ga0070703_10000310 3300005406 Bacteria 22294
9 Ga0070714_100030222 3300005435 Bacteria 4507
10 Ga0070700_100071363 3300005441 Bacteria 2217
11 Ga0070694_100574334 3300005444 Bacteria 905
12 Ga0070708_100021475 3300005445 Bacteria 5459
13 Ga0070708_100093275 3300005445 Bacteria 2744
14 Ga0070708_100140013 3300005445 Bacteria 2243
15 Ga0070708_100157609 3300005445 Bacteria 2114
16 Ga0070708_100296780 3300005445 Unclassified 1522
17 Ga0070708_100299265 3300005445 Bacteria 1515
18 Ga0070708_100463469 3300005445 Bacteria 1195
19 Ga0070708_100974831 3300005445 Bacteria 795
20 Ga0070681_10215799 3300005458 Bacteria 1834
21 Ga0070706_100001342 3300005467 Bacteria 26180
22 Ga0070706_100006838 3300005467 Bacteria 10767
23 Ga0070706_100039381 3300005467 Bacteria 4363
24 Ga0070706_100169155 3300005467 Bacteria 2041
25 Ga0070706_100351309 3300005467 Unclassified 1374
26 Ga0070706_101079580 3300005467 Unclassified 739
27 Ga0070707_100001810 3300005468 Bacteria 20550
28 Ga0070707_100097578 3300005468 Bacteria 2846
29 Ga0070707_100129392 3300005468 Bacteria 2454
30 Ga0070707_100367968 3300005468 Bacteria 1396
31 Ga0070698_100003154 3300005471 Bacteria 18170
32 Ga0070698_100095681 3300005471 Bacteria 2947
33 Ga0070698_100117022 3300005471 Bacteria 2628
34 Ga0070699_100040242 3300005518 Bacteria 4047
35 Ga0070699_100046052 3300005518 Bacteria 3774
36 Ga0070699_100049610 3300005518 Bacteria 3633
37 Ga0070679_100383096 3300005530 Bacteria 1353
38 Ga0070697_100025898 3300005536 Bacteria 4678
39 Ga0070697_100125881 3300005536 Bacteria 2146
40 Ga0070697_100471293 3300005536 Bacteria 1096
41 Ga0070697_100494838 3300005536 Bacteria 1069
42 Ga0070695_100088140 3300005545 Bacteria 2066
43 Ga0070696_100033770 3300005546 Bacteria 3518
44 Ga0070704_100104109 3300005549 Bacteria 2145
45 Ga0068857_100025138 3300005577 Bacteria 5245
46 Ga0068854_100131335 3300005578 Bacteria 1913
47 Ga0081539_10016069 3300005985 Bacteria 5381
48 Ga0075433_10078320 3300006852 Bacteria 2912
49 Ga0075433_10762841 3300006852 Bacteria 846
50 Ga0075434_100257134 3300006871 Unclassified 1765
51 Ga0075435_100149187 3300007076 Bacteria 1965
52 Ga0105240_10787171 3300009093 Bacteria 1031
53 Ga0105245_11136627 3300009098 Bacteria 828
54 Ga0114129_10012611 3300009147 Bacteria 12035
55 Ga0114129_10170918 3300009147 Bacteria 2963
56 Ga0114129_10492895 3300009147 Bacteria 1601
57 Ga0114129_10830703 3300009147 Bacteria 1176
58 Ga0105242_10359107 3300009176 Bacteria 1348
59 Ga0105248_10183012 3300009177 Bacteria 2361
60 Ga0105249_10325674 3300009553 Bacteria 1549
61 Ga0182008_10057187 3300014497 Bacteria 1926
62 Ga0207653_10000363 3300025885 Bacteria 21571
63 Ga0207684_10000100 3300025910 Bacteria 163084
64 Ga0207684_10012420 3300025910 Bacteria 7409
65 Ga0207684_10038536 3300025910 Bacteria 4055
66 Ga0207684_10093670 3300025910 Unclassified 2562
67 Ga0207684_10493713 3300025910 Bacteria 1050
68 Ga0207707_10076114 3300025912 Bacteria 2929
69 Ga0207707_10315204 3300025912 Unclassified 1351
70 Ga0207660_10515877 3300025917 Bacteria 970
71 Ga0207652_10198142 3300025921 Bacteria 1807
72 Ga0207652_10386626 3300025921 Bacteria 1263
73 Ga0207646_10000036 3300025922 Bacteria 197163
74 Ga0207646_10000289 3300025922 Bacteria 69345
75 Ga0207646_10001684 3300025922 Bacteria 26877
76 Ga0207646_10007855 3300025922 Bacteria 10779
77 Ga0207646_10045408 3300025922 Bacteria 3944
78 Ga0207646_10053023 3300025922 Bacteria 3628
79 Ga0207646_10088231 3300025922 Bacteria 2775
80 Ga0207646_10118839 3300025922 Bacteria 2374
81 Ga0207664_10101933 3300025929 Bacteria 2373
82 Ga0207664_10577736 3300025929 Bacteria 1009
83 Ga0207686_10314644 3300025934 Bacteria 1167
84 Ga0207679_10218439 3300025945 Bacteria 1603
85 Ga0207712_10298279 3300025961 Bacteria 1321
86 Ga0207708_10099389 3300026075 Bacteria 2250
87 Ga0207674_10032978 3300026116 Bacteria 5427
88 Ga0265319_1005925 3300028563 Bacteria 5748
89 Ga0265318_10120577 3300028577 Bacteria 964
90 Ga0265336_10016415 3300028666 Bacteria 2421
91 Ga0265336_10018882 3300028666 Bacteria 2229
92 Ga0265338_10003494 3300028800 Bacteria 22052
93 Ga0265338_10026073 3300028800 Bacteria 5908
94 Ga0265338_10086448 3300028800 Bacteria 2609
95 Ga0265338_10097604 3300028800 Bacteria 2406
96 Ga0265338_10231589 3300028800 Bacteria 1374
97 Ga0265320_10113069 3300031240 Bacteria 1242
98 Ga0265320_10162032 3300031240 Bacteria 1007
99 Ga0265329_10071632 3300031242 Bacteria 1097
100 Ga0265340_10099253 3300031247 Bacteria 1355
101 Ga0265316_10029299 3300031344 Bacteria 4528
102 Ga0265342_10098510 3300031712 Bacteria 1669
103 Ga0373941_0107548 3300035115 Bacteria 979
104 Ga0373937_1051778 3300036401 Bacteria 763
105 Ga0395899_0005711 3300037312 Bacteria 9658
106 Ga0395899_0025783 3300037312 Bacteria 4437
107 Ga0395899_0440875 3300037312 Bacteria 855
108 Ga0395900_0002676 3300037418 Bacteria 19469
109 Ga0395900_0205286 3300037418 Bacteria 1992
110 Ga0395898_0012262 3300037466 Bacteria 8863
111 Ga0395898_0013668 3300037466 Bacteria 8351
112 Ga0395898_0174300 3300037466 Bacteria 2056
113 Ga0395898_0240987 3300037466 Bacteria 1725
114 Ga0395898_0523575 3300037466 Bacteria 1127
115 Ga0395905_0002174 3300037471 Bacteria 22178
116 Ga0395905_0254085 3300037471 Bacteria 1642
117 Ga0395901_0072842 3300038443 Bacteria 3581
118 Ga0395901_0192660 3300038443 Bacteria 2138
119 Ga0395901_0321897 3300038443 Bacteria 1600
120 Ga0395901_0578809 3300038443 Bacteria 1135
121 Ga0439435_0075788 3300042436 Bacteria 1002
122 Ga0466965_0070907 3300044683 Bacteria 1752
123 Ga0466963_0067477 3300044694 Bacteria 2401
124 Ga0466968_0008749 3300044735 Bacteria 3882
125 Ga0466958_0020518 3300045836 Bacteria 3855
126 Ga0466958_0088175 3300045836 Bacteria 1917
127 Ga0466958_0147907 3300045836 Bacteria 1481
128 Ga0466967_0006322 3300045976 Bacteria 8364
129 Ga0466967_0027389 3300045976 Bacteria 4740
130 Ga0466967_0062502 3300045976 Bacteria 3305
131 Ga0466967_0085759 3300045976 Bacteria 2852
132 Ga0466967_0136397 3300045976 Bacteria 2282
133 Ga0466967_0504793 3300045976 Bacteria 1187
134 Ga0466967_0861878 3300045976 Bacteria 900
135 Ga0495608_0365785 3300046511 Unclassified 886
136 Ga0495618_0415031 3300046514 Bacteria 821
137 Ga0495658_0219226 3300046683 Bacteria 1190
138 Ga0495613_0321396 3300046689 Bacteria 1068
139 Ga0495624_0096390 3300046690 Bacteria 1822
140 Ga0495684_0269525 3300047471 Bacteria 1232
141 Ga0501067_0122210 3300049583 Bacteria 1449
142 Ga0501069_0222332 3300049585 Bacteria 1098
143 Ga0501070_0197482 3300049586 Bacteria 1652
144 nmdc:mga05p37_1395674_c1 3300050507 Archaea 706
145 nmdc:mga05p37_367312_c1 3300050507 Bacteria 1690
146 nmdc:mga05p37_384782_c1 3300050507 Bacteria 1643
147 nmdc:mga05p37_438692_c1 3300050507 Bacteria 1515
148 nmdc:mga0a205_39275_c1 3300050515 Bacteria 4556
149 Ga0495601_0002034 3300053077 Bacteria 11354
150 Ga0495619_0002315 3300053085 Bacteria 12547
151 Ga0500553_007235 3300053101 Bacteria 5501
152 Ga0500560_000417 3300053107 Bacteria 5822
153 Ga0500573_0005387 3300053140 Bacteria 6855
154 Ga0068870_10332298
155 Ga0065715_10091747
156 Ga0070658_10294554
157 Ga0070680_100738205
158 Ga0070692_10001027
159 Ga0070673_100196207
160 Ga0070667_100604915
161 Ga0070703_10000310
162 Ga0070714_100030222
163 Ga0070700_100071363
164 Ga0070694_100574334
165 Ga0070708_100021475
166 Ga0070708_100093275
167 Ga0070708_100140013
168 Ga0070708_100157609
169 Ga0070708_100296780
170 Ga0070708_100299265
171 Ga0070708_100463469
172 Ga0070708_100974831
173 Ga0070681_10215799
174 Ga0070706_100001342
175 Ga0070706_100006838
176 Ga0070706_100039381
177 Ga0070706_100169155
178 Ga0070706_100351309
179 Ga0070706_101079580
180 Ga0070707_100001810
181 Ga0070707_100097578
182 Ga0070707_100129392
183 Ga0070707_100367968
184 Ga0070698_100003154
185 Ga0070698_100095681
186 Ga0070698_100117022
187 Ga0070699_100040242
188 Ga0070699_100046052
189 Ga0070699_100049610
190 Ga0070679_100383096
191 Ga0070697_100025898
192 Ga0070697_100125881
193 Ga0070697_100471293
194 Ga0070697_100494838
195 Ga0070695_100088140
196 Ga0070696_100033770
197 Ga0070704_100104109
198 Ga0068857_100025138
199 Ga0068854_100131335
200 Ga0081539_10016069
201 Ga0075433_10078320
202 Ga0075433_10762841
203 Ga0075434_100257134
204 Ga0075435_100149187
205 Ga0105240_10787171
206 Ga0105245_11136627
207 Ga0114129_10012611
208 Ga0114129_10170918
209 Ga0114129_10492895
210 Ga0114129_10830703
211 Ga0105242_10359107
212 Ga0105248_10183012
213 Ga0105249_10325674
214 Ga0182008_10057187
215 Ga0207653_10000363
216 Ga0207684_10000100
217 Ga0207684_10012420
218 Ga0207684_10038536
219 Ga0207684_10093670
220 Ga0207684_10493713
221 Ga0207707_10076114
222 Ga0207707_10315204
223 Ga0207660_10515877
224 Ga0207652_10198142
225 Ga0207652_10386626
226 Ga0207646_10000036
227 Ga0207646_10000289
228 Ga0207646_10001684
229 Ga0207646_10007855
230 Ga0207646_10045408
231 Ga0207646_10053023
232 Ga0207646_10088231
233 Ga0207646_10118839
234 Ga0207664_10101933
235 Ga0207664_10577736
236 Ga0207686_10314644
237 Ga0207679_10218439
238 Ga0207712_10298279
239 Ga0207708_10099389
240 Ga0207674_10032978
241 Ga0265319_1005925
242 Ga0265318_10120577
243 Ga0265336_10016415
244 Ga0265336_10018882
245 Ga0265338_10003494
246 Ga0265338_10026073
247 Ga0265338_10086448
248 Ga0265338_10097604
249 Ga0265338_10231589
250 Ga0265320_10113069
251 Ga0265320_10162032
252 Ga0265329_10071632
253 Ga0265340_10099253
254 Ga0265316_10029299
255 Ga0265342_10098510
256 Ga0373941_0107548
257 Ga0373937_1051778
258 Ga0395899_0005711
259 Ga0395899_0025783
260 Ga0395899_0440875
261 Ga0395900_0002676
262 Ga0395900_0205286
263 Ga0395898_0012262
264 Ga0395898_0013668
265 Ga0395898_0174300
266 Ga0395898_0240987
267 Ga0395898_0523575
268 Ga0395905_0002174
269 Ga0395905_0254085
270 Ga0395901_0072842
271 Ga0395901_0192660
272 Ga0395901_0321897
273 Ga0395901_0578809
274 Ga0439435_0075788
275 Ga0466965_0070907
276 Ga0466963_0067477
277 Ga0466968_0008749
278 Ga0466958_0020518
279 Ga0466958_0088175
280 Ga0466958_0147907
281 Ga0466967_0006322
282 Ga0466967_0027389
283 Ga0466967_0062502
284 Ga0466967_0085759
285 Ga0466967_0136397
286 Ga0466967_0504793
287 Ga0466967_0861878
288 Ga0495608_0365785
289 Ga0495618_0415031
290 Ga0495658_0219226
291 Ga0495613_0321396
292 Ga0495624_0096390
293 Ga0495684_0269525
294 Ga0501067_0122210
295 Ga0501069_0222332
296 Ga0501070_0197482
297 nmdc:mga05p37_1395674_c1
298 nmdc:mga05p37_367312_c1
299 nmdc:mga05p37_384782_c1
300 nmdc:mga05p37_438692_c1
301 nmdc:mga0a205_39275_c1
302 Ga0495601_0002034
303 Ga0495619_0002315
304 Ga0500553_007235
305 Ga0500560_000417
306 Ga0500573_0005387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

5

91

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.9113 3 188
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8698 3 188
7unl-assembly1.cif.gz_A human tmem175 in an open state 0.8055 1 188
6w8p-assembly1.cif.gz_A structure of membrane protein with ions 0.8044 1 188
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.8028 1 185
ID Description Score Start End Superfamily
3t9oB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain 0.7712 67 131 1.20.120.30
af_Q9CXY1_354_499_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6534 93 189 1.10.287.70
af_G5EGK1_693_820_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6061 42 172 1.20.120.230
af_G5EGK1_693_820_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5838 42 172 1.20.120.230
af_P0CE94_859_989_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5758 40 181 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A536FJH7-F1-model_v4 DUF1211 domain-containing protein 0.9867 1 140 GO:0005267
GO:0015252
GO:0016020
AF-A0A535RUR2-F1-model_v4 DUF1211 domain-containing protein 0.9757 1 132 GO:0005267
GO:0015252
GO:0016020
AF-A0A535HJ96-F1-model_v4 DUF1211 domain-containing protein 0.9686 3 196 GO:0005267
GO:0015252
GO:0016020
AF-A0A7G6Z9Z5-F1-model_v4 DUF1211 domain-containing protein 0.9649 3 188 GO:0005267
GO:0015252
GO:0016020
AF-A0A535RUR2-F1-model_v4 DUF1211 domain-containing protein 0.9614 1 132 GO:0005267
GO:0015252
GO:0016020

Map