F216482

General Info

Members Datasets Scaffolds Average Seq Length
153 106 153 105

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100011930|Ga0068857_10001193011
Length 117
Sequence MMHDWNFAVIENFDVPARSEFKAKVMELMAQVPRGRVTTYGDLAAMAGHPYAARIVGGMAHYGDTELPWHRLVNRFGGLASGYYGGREVQAQHLAAEGITCTDFIVDNFKEIRWQPI

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
27 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
48 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
49 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
50 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
51 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
52 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
58 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
59 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
60 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
63 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
64 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
65 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
87 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
90 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
91 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
94 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
95 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
96 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
97 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
98 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
99 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
100 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
101 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
102 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
103 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
106 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.1
Nodule 0
Rhizoplane 1.31
Rhizosphere 68.63
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10028133 3300001989 Bacteria 1962
2 rootH2_10004334 3300003320 Bacteria 85448
3 rootH1_10319794 3300003323 Bacteria 1292
4 Ga0065715_10098110 3300005293 Bacteria 3596
5 Ga0070670_100014843 3300005331 Bacteria 6680
6 Ga0070660_100000556 3300005339 Bacteria 25047
7 Ga0068855_100000002 3300005563 Bacteria 616881
8 Ga0068857_100000322 3300005577 Bacteria 32987
9 Ga0068857_100011930 3300005577 Bacteria 7557
10 Ga0068854_100007314 3300005578 Bacteria 7056
11 Ga0068856_100060402 3300005614 Bacteria 3745
12 Ga0068856_100740053 3300005614 Bacteria 1003
13 Ga0068852_100000001 3300005616 Bacteria 716526
14 Ga0068852_100022775 3300005616 Bacteria 5030
15 Ga0068863_101956580 3300005841 Unclassified 596
16 Ga0068858_100417378 3300005842 Bacteria 1290
17 Ga0081539_10170380 3300005985 Unclassified 1030
18 Ga0075365_10000054 3300006038 Bacteria 35938
19 Ga0075365_10000080 3300006038 Bacteria 27892
20 Ga0075365_10268776 3300006038 Bacteria 1199
21 Ga0075363_100001478 3300006048 Bacteria 8944
22 Ga0075364_10000937 3300006051 Bacteria 15385
23 Ga0075367_10000339 3300006178 Bacteria 16665
24 Ga0075366_10642679 3300006195 Unclassified 658
25 Ga0075370_10033348 3300006353 Bacteria 2883
26 Ga0075370_10067553 3300006353 Bacteria 2041
27 Ga0075428_100001012 3300006844 Bacteria 29814
28 Ga0105240_10000030 3300009093 Bacteria 321312
29 Ga0105240_10000886 3300009093 Bacteria 53766
30 Ga0105240_10613935 3300009093 Unclassified 1196
31 Ga0105241_10001961 3300009174 Bacteria 15578
32 Ga0105237_10000001 3300009545 Bacteria 1009213
33 Ga0105237_10000159 3300009545 Bacteria 95980
34 Ga0105238_10000480 3300009551 Bacteria 41924
35 Ga0105032_100009 3300009979 Bacteria 86569
36 Ga0105032_100012 3300009979 Bacteria 73994
37 Ga0105028_100052 3300009993 Bacteria 12313
38 Ga0105246_12604714 3300011119 Unclassified 500
39 Ga0157371_10062378 3300013102 Bacteria 2642
40 Ga0157371_10748664 3300013102 Unclassified 734
41 Ga0157370_10010096 3300013104 Bacteria 9974
42 Ga0157369_10000003 3300013105 Bacteria 507337
43 Ga0157369_10576616 3300013105 Bacteria 1162
44 Ga0157369_12277046 3300013105 Unclassified 549
45 Ga0157369_12622783 3300013105 Unclassified 509
46 Ga0157374_10257900 3300013296 Bacteria 1717
47 Ga0157372_10000007 3300013307 Bacteria 340690
48 Ga0157372_10000096 3300013307 Bacteria 91282
49 Ga0157372_10126879 3300013307 Bacteria 2934
50 Ga0157372_12066162 3300013307 Unclassified 655
51 Ga0207695_10000009 3300025913 Bacteria 1034276
52 Ga0207695_10014524 3300025913 Bacteria 9322
53 Ga0207695_10415229 3300025913 Bacteria 1230
54 Ga0207671_10000003 3300025914 Bacteria 1065461
55 Ga0207671_10000008 3300025914 Bacteria 798229
56 Ga0207657_10002368 3300025919 Bacteria 20388
57 Ga0207694_10003439 3300025924 Bacteria 12588
58 Ga0207650_10045649 3300025925 Bacteria 3224
59 Ga0207667_10000005 3300025949 Bacteria 715503
60 Ga0207667_10000048 3300025949 Bacteria 238293
61 Ga0207667_10009157 3300025949 Bacteria 11694
62 Ga0207640_10012750 3300025981 Bacteria 4798
63 Ga0207677_10542979 3300026023 Unclassified 1012
64 Ga0207703_10702189 3300026035 Unclassified 962
65 Ga0207702_11145231 3300026078 Unclassified 772
66 Ga0207674_10000563 3300026116 Bacteria 48522
67 Ga0207674_10026683 3300026116 Bacteria 6128
68 Ga0207698_10000169 3300026142 Bacteria 40939
69 Ga0207698_10210274 3300026142 Bacteria 1750
70 Ga0209813_10000225 3300027866 Bacteria 17310
71 Ga0316176_1152613 3300030732 Unclassified 688
72 Ga0314311_1257351 3300030733 Bacteria 1621
73 Ga0316180_1021397 3300030736 Bacteria 4578
74 Ga0316183_1035366 3300030742 Bacteria 8896
75 Ga0316183_1046091 3300030742 Unclassified 1529
76 Ga0316183_1127953 3300030742 Bacteria 6162
77 Ga0316183_1165569 3300030742 Bacteria 12666
78 Ga0316181_1123581 3300030744 Bacteria 76132
79 Ga0316182_1019627 3300030745 Bacteria 7628
80 Ga0316182_1073426 3300030745 Bacteria 8993
81 Ga0316182_1110800 3300030745 Bacteria 3308
82 Ga0316182_1280922 3300030745 Bacteria 2396
83 Ga0316182_1344828 3300030745 Bacteria 1277
84 Ga0316182_1379566 3300030745 Bacteria 4844
85 Ga0307405_10035322 3300031731 Bacteria 2984
86 Ga0307406_10000897 3300031901 Bacteria 16719
87 Ga0307411_10407290 3300032005 Bacteria 1126
88 Ga0395901_0096177 3300038443 Unclassified 3104
89 Ga0395901_0881231 3300038443 Bacteria 878
90 Ga0439461_0002338 3300041410 Bacteria 3016
91 Ga0451802_1938230 3300041460 Unclassified 508
92 Ga0439432_058307 3300042006 Unclassified 1194
93 Ga0450919_002828 3300042121 Bacteria 2228
94 Ga0450906_002379 3300042145 Bacteria 4117
95 Ga0439446_0000002 3300042156 Bacteria 177065
96 Ga0450909_048267 3300042185 Bacteria 662
97 Ga0439459_0249898 3300042438 Bacteria 501
98 Ga0450918_001400 3300042531 Bacteria 4811
99 Ga0450918_017777 3300042531 Bacteria 1239
100 Ga0466972_0314731 3300044658 Bacteria 731
101 Ga0466965_0000828 3300044683 Bacteria 11698
102 Ga0453684_1118824 3300044712 Bacteria 831
103 Ga0466970_0115113 3300044765 Unclassified 1470
104 Ga0466970_0740280 3300044765 Bacteria 574
105 Ga0451576_0172601 3300045051 Bacteria 2257
106 Ga0495638_0000119 3300046460 Bacteria 127603
107 Ga0495597_0165188 3300046542 Bacteria 901
108 Ga0495671_0118651 3300046692 Bacteria 1291
109 Ga0495660_0000114 3300046810 Bacteria 86218
110 Ga0495660_0244589 3300046810 Unclassified 835
111 Ga0495686_0014394 3300047472 Bacteria 5446
112 Ga0496115_0000049 3300048918 Bacteria 109919
113 Ga0496124_0172739 3300048927 Bacteria 1672
114 Ga0501034_0000187 3300049571 Bacteria 116046
115 Ga0501034_0404603 3300049571 Bacteria 1287
116 Ga0501037_0000001 3300049573 Bacteria 753276
117 Ga0501038_0016252 3300049574 Bacteria 6749
118 Ga0501070_0714741 3300049586 Unclassified 792
119 Ga0501080_0953449 3300049742 Unclassified 746
120 Ga0501044_0894449 3300049823 Unclassified 763
121 nmdc:mga03683_170444_c1 3300050489 Unclassified 989
122 nmdc:mga00v17_1352_c1 3300050491 Bacteria 12824
123 nmdc:mga0yw44_126_c1 3300050492 Bacteria 26586
124 nmdc:mga0yw44_226599_c1 3300050492 Bacteria 1240
125 nmdc:mga0yw44_242108_c1 3300050492 Bacteria 1199
126 nmdc:mga0yw44_3127_c1 3300050492 Bacteria 7266
127 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
128 nmdc:mga0k408_675851_c1 3300050493 Bacteria 606
129 nmdc:mga06z11_149972_c1 3300050494 Unclassified 1325
130 nmdc:mga04h51_364451_c1 3300050495 Unclassified 600
131 nmdc:mga07m45_32769_c1 3300050496 Bacteria 2882
132 nmdc:mga0sz30_2062_c1 3300050516 Bacteria 2688
133 Ga0500644_0005668 3300053088 Bacteria 3158
134 Ga0500583_0000444 3300053092 Bacteria 13051
135 Ga0500583_0006729 3300053092 Bacteria 3983
136 Ga0500651_0000043 3300053093 Bacteria 86502
137 Ga0500641_0000001 3300053096 Bacteria 1115973
138 Ga0500650_0015058 3300053098 Bacteria 3286
139 Ga0500650_0261960 3300053098 Unclassified 773
140 Ga0500555_000005 3300053103 Bacteria 342334
141 Ga0500569_000002 3300053109 Bacteria 127605
142 Ga0500594_0000255 3300053118 Bacteria 12627
143 Ga0500652_000001 3300053131 Bacteria 946868
144 Ga0500655_000147 3300053133 Bacteria 17635
145 Ga0500577_0000906 3300053142 Bacteria 7676
146 Ga0500577_0222368 3300053142 Unclassified 817
147 Ga0500588_0000025 3300053146 Bacteria 35507
148 Ga0500616_0000067 3300053153 Bacteria 236311
149 Ga0500616_0023038 3300053153 Bacteria 3473
150 Ga0500616_0057176 3300053153 Bacteria 2033
151 Ga0500633_0162992 3300053160 Unclassified 837
152 Ga0500570_001248 3300053724 Bacteria 11491
153 Ga0500570_182653 3300053724 Unclassified 673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10170380 Ga0081539_101703802 89
2 3300009993 Ga0105028_100052 Ga0105028_1000529 100
3 3300005563 Ga0068855_100000002 Ga0068855_100000002662 101
4 3300009093 Ga0105240_10613935 Ga0105240_106139352 101
5 3300025913 Ga0207695_10415229 Ga0207695_104152292 101
6 3300025949 Ga0207667_10000005 Ga0207667_10000005771 101
7 3300026023 Ga0207677_10542979 Ga0207677_105429792 101
8 3300005616 Ga0068852_100022775 Ga0068852_1000227756 102
9 3300005841 Ga0068863_101956580 Ga0068863_1019565802 102
10 3300013105 Ga0157369_10000003 Ga0157369_1000000321 102
11 3300032005 Ga0307411_10407290 Ga0307411_104072902 102
12 3300038443 Ga0395901_0096177 Ga0395901_0096177_1292_1648 102
13 3300049571 Ga0501034_0000187 Ga0501034_0000187_40317_40628 102
14 3300053093 Ga0500651_0000043 Ga0500651_0000043_26975_27283 102
15 3300005293 Ga0065715_10098110 Ga0065715_100981105 103
16 3300005339 Ga0070660_100000556 Ga0070660_1000005566 103
17 3300005577 Ga0068857_100000322 Ga0068857_10000032218 103
18 3300005577 Ga0068857_100011930 Ga0068857_10001193011 103
19 3300005616 Ga0068852_100000001 Ga0068852_10000000123 103
20 3300005842 Ga0068858_100417378 Ga0068858_1004173782 103
21 3300006038 Ga0075365_10000080 Ga0075365_1000008036 103
22 3300006048 Ga0075363_100001478 Ga0075363_10000147813 103
23 3300006051 Ga0075364_10000937 Ga0075364_1000093719 103
24 3300006178 Ga0075367_10000339 Ga0075367_100003399 103
25 3300006195 Ga0075366_10642679 Ga0075366_106426792 103
26 3300009093 Ga0105240_10000030 Ga0105240_10000030353 103
27 3300009174 Ga0105241_10001961 Ga0105241_1000196122 103
28 3300009545 Ga0105237_10000001 Ga0105237_1000000122 103
29 3300009545 Ga0105237_10000159 Ga0105237_1000015985 103
30 3300009551 Ga0105238_10000480 Ga0105238_1000048012 103
31 3300013102 Ga0157371_10062378 Ga0157371_100623782 103
32 3300013104 Ga0157370_10010096 Ga0157370_1001009611 103
33 3300013105 Ga0157369_12277046 Ga0157369_122770461 103
34 3300013296 Ga0157374_10257900 Ga0157374_102579003 103
35 3300013307 Ga0157372_10000007 Ga0157372_1000000722 103
36 3300013307 Ga0157372_10000096 Ga0157372_1000009622 103
37 3300013307 Ga0157372_12066162 Ga0157372_120661621 103
38 3300025913 Ga0207695_10000009 Ga0207695_1000000922 103
39 3300025914 Ga0207671_10000003 Ga0207671_1000000322 103
40 3300025914 Ga0207671_10000008 Ga0207671_1000000822 103
41 3300025919 Ga0207657_10002368 Ga0207657_1000236820 103
42 3300025924 Ga0207694_10003439 Ga0207694_100034394 103
43 3300026035 Ga0207703_10702189 Ga0207703_107021892 103
44 3300026116 Ga0207674_10000563 Ga0207674_1000056334 103
45 3300026116 Ga0207674_10026683 Ga0207674_100266836 103
46 3300026142 Ga0207698_10000169 Ga0207698_1000016922 103
47 3300027866 Ga0209813_10000225 Ga0209813_1000022524 103
48 3300030733 Ga0314311_1257351 Ga0314311_12573512 103
49 3300030736 Ga0316180_1021397 Ga0316180_10213972 103
50 3300030742 Ga0316183_1165569 Ga0316183_11655699 103
51 3300030745 Ga0316182_1073426 Ga0316182_10734264 103
52 3300031731 Ga0307405_10035322 Ga0307405_100353222 103
53 3300031901 Ga0307406_10000897 Ga0307406_1000089717 103
54 3300041410 Ga0439461_0002338 Ga0439461_0002338_1447_1758 103
55 3300042121 Ga0450919_002828 Ga0450919_002828_1655_1975 103
56 3300042438 Ga0439459_0249898 Ga0439459_0249898_82_393 103
57 3300044658 Ga0466972_0314731 Ga0466972_0314731_32_343 103
58 3300044683 Ga0466965_0000828 Ga0466965_0000828_10707_11018 103
59 3300044712 Ga0453684_1118824 Ga0453684_1118824_458_781 103
60 3300044765 Ga0466970_0115113 Ga0466970_0115113_249_560 103
61 3300044765 Ga0466970_0740280 Ga0466970_0740280_100_411 103
62 3300045051 Ga0451576_0172601 Ga0451576_0172601_1001_1321 103
63 3300047472 Ga0495686_0014394 Ga0495686_0014394_2136_2447 103
64 3300048918 Ga0496115_0000049 Ga0496115_0000049_28978_29289 103
65 3300049571 Ga0501034_0404603 Ga0501034_0404603_555_866 103
66 3300049573 Ga0501037_0000001 Ga0501037_0000001_671190_671501 103
67 3300049574 Ga0501038_0016252 Ga0501038_0016252_1461_1772 103
68 3300049742 Ga0501080_0953449 Ga0501080_0953449_80_391 103
69 3300049823 Ga0501044_0894449 Ga0501044_0894449_227_538 103
70 3300050489 nmdc:mga03683_170444_c1 nmdc:mga03683_170444_c1_525_836 103
71 3300050491 nmdc:mga00v17_1352_c1 nmdc:mga00v17_1352_c1_7531_7842 103
72 3300050492 nmdc:mga0yw44_126_c1 nmdc:mga0yw44_126_c1_4572_4883 103
73 3300050492 nmdc:mga0yw44_3127_c1 nmdc:mga0yw44_3127_c1_124_435 103
74 3300050494 nmdc:mga06z11_149972_c1 nmdc:mga06z11_149972_c1_827_1138 103
75 3300050495 nmdc:mga04h51_364451_c1 nmdc:mga04h51_364451_c1_271_582 103
76 3300050516 nmdc:mga0sz30_2062_c1 nmdc:mga0sz30_2062_c1_706_1017 103
77 3300053092 Ga0500583_0006729 Ga0500583_0006729_2040_2351 103
78 3300053142 Ga0500577_0222368 Ga0500577_0222368_271_582 103
79 3300053153 Ga0500616_0023038 Ga0500616_0023038_901_1212 103
80 3300001989 JGI24739J22299_10028133 JGI24739J22299_100281333 104
81 3300003320 rootH2_10004334 rootH2_1000433420 104
82 3300003323 rootH1_10319794 rootH1_103197942 104
83 3300005331 Ga0070670_100014843 Ga0070670_1000148435 104
84 3300005578 Ga0068854_100007314 Ga0068854_1000073144 104
85 3300005614 Ga0068856_100060402 Ga0068856_1000604022 104
86 3300005614 Ga0068856_100740053 Ga0068856_1007400532 104
87 3300006038 Ga0075365_10000054 Ga0075365_1000005424 104
88 3300006038 Ga0075365_10268776 Ga0075365_102687763 104
89 3300006353 Ga0075370_10033348 Ga0075370_100333482 104
90 3300006353 Ga0075370_10067553 Ga0075370_100675532 104
91 3300006844 Ga0075428_100001012 Ga0075428_10000101228 104
92 3300009093 Ga0105240_10000886 Ga0105240_1000088663 104
93 3300009979 Ga0105032_100009 Ga0105032_10000976 104
94 3300009979 Ga0105032_100012 Ga0105032_10001260 104
95 3300011119 Ga0105246_12604714 Ga0105246_126047141 104
96 3300013102 Ga0157371_10748664 Ga0157371_107486642 104
97 3300013105 Ga0157369_10576616 Ga0157369_105766163 104
98 3300013105 Ga0157369_12622783 Ga0157369_126227832 104
99 3300013307 Ga0157372_10126879 Ga0157372_101268793 104
100 3300025913 Ga0207695_10014524 Ga0207695_100145246 104
101 3300025925 Ga0207650_10045649 Ga0207650_100456492 104
102 3300025949 Ga0207667_10000048 Ga0207667_10000048257 104
103 3300025949 Ga0207667_10009157 Ga0207667_100091576 104
104 3300025981 Ga0207640_10012750 Ga0207640_100127502 104
105 3300026078 Ga0207702_11145231 Ga0207702_111452312 104
106 3300026142 Ga0207698_10210274 Ga0207698_102102742 104
107 3300030732 Ga0316176_1152613 Ga0316176_11526132 104
108 3300030742 Ga0316183_1035366 Ga0316183_10353669 104
109 3300030742 Ga0316183_1046091 Ga0316183_10460912 104
110 3300030742 Ga0316183_1127953 Ga0316183_112795310 104
111 3300030744 Ga0316181_1123581 Ga0316181_112358113 104
112 3300030745 Ga0316182_1019627 Ga0316182_10196279 104
113 3300030745 Ga0316182_1110800 Ga0316182_11108004 104
114 3300030745 Ga0316182_1280922 Ga0316182_12809222 104
115 3300030745 Ga0316182_1344828 Ga0316182_13448282 104
116 3300030745 Ga0316182_1379566 Ga0316182_13795668 104
117 3300038443 Ga0395901_0881231 Ga0395901_0881231_280_594 104
118 3300041460 Ga0451802_1938230 Ga0451802_1938230_104_445 104
119 3300042006 Ga0439432_058307 Ga0439432_058307_47_379 104
120 3300042145 Ga0450906_002379 Ga0450906_002379_1827_2141 104
121 3300042156 Ga0439446_0000002 Ga0439446_0000002_25667_25981 104
122 3300042185 Ga0450909_048267 Ga0450909_048267_161_475 104
123 3300042531 Ga0450918_001400 Ga0450918_001400_1525_1839 104
124 3300042531 Ga0450918_017777 Ga0450918_017777_330_644 104
125 3300046460 Ga0495638_0000119 Ga0495638_0000119_54024_54338 104
126 3300046542 Ga0495597_0165188 Ga0495597_0165188_450_764 104
127 3300046692 Ga0495671_0118651 Ga0495671_0118651_561_875 104
128 3300046810 Ga0495660_0000114 Ga0495660_0000114_64143_64457 104
129 3300046810 Ga0495660_0244589 Ga0495660_0244589_508_822 104
130 3300048927 Ga0496124_0172739 Ga0496124_0172739_1338_1652 104
131 3300049586 Ga0501070_0714741 Ga0501070_0714741_241_573 104
132 3300050492 nmdc:mga0yw44_226599_c1 nmdc:mga0yw44_226599_c1_268_582 104
133 3300050492 nmdc:mga0yw44_242108_c1 nmdc:mga0yw44_242108_c1_118_435 104
134 3300050492 nmdc:mga0yw44_5_c1 nmdc:mga0yw44_5_c1_290911_291252 104
135 3300050493 nmdc:mga0k408_675851_c1 nmdc:mga0k408_675851_c1_128_442 104
136 3300050496 nmdc:mga07m45_32769_c1 nmdc:mga07m45_32769_c1_573_887 104
137 3300053088 Ga0500644_0005668 Ga0500644_0005668_2498_2812 104
138 3300053092 Ga0500583_0000444 Ga0500583_0000444_10213_10527 104
139 3300053096 Ga0500641_0000001 Ga0500641_0000001_683715_684029 104
140 3300053098 Ga0500650_0015058 Ga0500650_0015058_815_1129 104
141 3300053098 Ga0500650_0261960 Ga0500650_0261960_348_662 104
142 3300053103 Ga0500555_000005 Ga0500555_000005_308337_308678 104
143 3300053109 Ga0500569_000002 Ga0500569_000002_73266_73580 104
144 3300053118 Ga0500594_0000255 Ga0500594_0000255_3954_4304 104
145 3300053131 Ga0500652_000001 Ga0500652_000001_797399_797713 104
146 3300053133 Ga0500655_000147 Ga0500655_000147_12510_12833 104
147 3300053142 Ga0500577_0000906 Ga0500577_0000906_1805_2122 104
148 3300053146 Ga0500588_0000025 Ga0500588_0000025_15643_15957 104
149 3300053153 Ga0500616_0000067 Ga0500616_0000067_192022_192336 104
150 3300053153 Ga0500616_0057176 Ga0500616_0057176_1551_1865 104
151 3300053160 Ga0500633_0162992 Ga0500633_0162992_344_658 104
152 3300053724 Ga0500570_001248 Ga0500570_001248_7217_7564 104
153 3300053724 Ga0500570_182653 Ga0500570_182653_48_362 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

20

99

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.9217 6 84
4wx9-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.9146 6 83
1t39-assembly2.cif.gz_B human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna 0.8955 7 84
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.885 7 83
7e1p-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii o6-methylguanine methyltransferase c120s variant in complex with o6-methyldeoxyguanosine 0.881 7 87
ID Description Score Start End Superfamily
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9465 6 102 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9434 7 83 1.10.10.10
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9179 6 102 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9144 6 83 1.10.10.10
af_A0A1D8PU47_6_130_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8946 7 103 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1M3BTV1-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 1.001 4 102 GO:0003824
GO:0006281
AF-A0A258G637-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9953 7 104 GO:0003824
GO:0006281
AF-A0A0G1VD76-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9894 3 103 GO:0003824
GO:0006281
AF-A0A2V9R6E2-F1-model_v4 Cysteine methyltransferase 0.987 7 61 GO:0006281
GO:0008168
GO:0032259
AF-A0A258G2L5-F1-model_v4 Cysteine methyltransferase 0.9854 16 102 GO:0006281
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
95.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map