F216442

General Info

Members Datasets Scaffolds Average Seq Length
153 93 306 280

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100184521|Ga0070696_1001845212
Length 308
Sequence MSKVQCPKSEGWAWAFDFGLWTLDFGRLMRILVTGGSGYLGTHVRHFLAADDFSRRSGRDILSDDDLKLVADYDAVIHLAAYLDKNPEGSELCFITNANAAANVVKNMRPGASFIYASTKDVYGGNADSYAEVPETCPTNYSGQTALEWSKLIGERYVEYYARQSGIRACIFRMSNIYARPSRGNESGFVSHYVESVKRGWPIRLPLDGQPIRDILHVDDFSRACRAFIDSPHVYGLYNLGGGKENSASLIDIVSSVGRMIELEPNIVNDATLPHPVPVNYVSDLTRIREQLGWQPQIGIEEGLRSLL

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
85 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 26.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100184521 3300005546 Bacteria 1549
2 SwRhRL2b_contig_2396006 2162886007 Bacteria 2178
3 LJNas_1005973 3300000546 Bacteria 1322
4 Ga0065715_10111263 3300005293 Unclassified 2572
5 Ga0065715_10242745 3300005293 Bacteria 1193
6 Ga0065707_10096682 3300005295 Unclassified 3239
7 Ga0065707_10161241 3300005295 Bacteria 1561
8 Ga0070690_100015716 3300005330 Bacteria 4521
9 Ga0070690_100054458 3300005330 Bacteria 2561
10 Ga0070670_100008536 3300005331 Bacteria 8739
11 Ga0070670_100116179 3300005331 Unclassified 2307
12 Ga0068869_100012749 3300005334 Bacteria 5560
13 Ga0068869_100204621 3300005334 Bacteria 1558
14 Ga0070666_10141738 3300005335 Unclassified 1674
15 Ga0070680_100261265 3300005336 Bacteria 1465
16 Ga0070682_100005007 3300005337 Bacteria 7364
17 Ga0070689_100036175 3300005340 Bacteria 3776
18 Ga0070668_100012907 3300005347 Bacteria 6223
19 Ga0070669_100003156 3300005353 Bacteria 11851
20 Ga0070669_100059107 3300005353 Unclassified 2815
21 Ga0070673_100013168 3300005364 Bacteria 5708
22 Ga0070673_100146451 3300005364 Unclassified 1997
23 Ga0070673_100270185 3300005364 Bacteria 1488
24 Ga0070703_10053211 3300005406 Bacteria 1301
25 Ga0070705_100035424 3300005440 Bacteria 2798
26 Ga0070700_100108769 3300005441 Bacteria 1839
27 Ga0070700_100347220 3300005441 Bacteria 1099
28 Ga0070694_100015351 3300005444 Unclassified 4809
29 Ga0070708_100000123 3300005445 Bacteria 52148
30 Ga0070662_100306602 3300005457 Bacteria 1291
31 Ga0070681_10627647 3300005458 Unclassified 989
32 Ga0070706_100008396 3300005467 Bacteria 9624
33 Ga0070706_100011966 3300005467 Bacteria 8051
34 Ga0070706_100110475 3300005467 Bacteria 2558
35 Ga0070706_100530366 3300005467 Bacteria 1095
36 Ga0070707_100006719 3300005468 Bacteria 10660
37 Ga0070707_100187245 3300005468 Bacteria 2018
38 Ga0070707_100385445 3300005468 Bacteria 1361
39 Ga0070698_100002252 3300005471 Bacteria 21345
40 Ga0070698_100008896 3300005471 Bacteria 10792
41 Ga0070698_100016061 3300005471 Bacteria 7904
42 Ga0070699_100001087 3300005518 Bacteria 25323
43 Ga0070699_100043447 3300005518 Unclassified 3890
44 Ga0070699_100167245 3300005518 Bacteria 1948
45 Ga0070697_100000395 3300005536 Bacteria 33783
46 Ga0070697_100022993 3300005536 Unclassified 4957
47 Ga0070697_100024678 3300005536 Bacteria 4788
48 Ga0070686_100015204 3300005544 Unclassified 4451
49 Ga0070686_100056274 3300005544 Unclassified 2522
50 Ga0070686_100145800 3300005544 Bacteria 1653
51 Ga0070695_100133219 3300005545 Bacteria 1715
52 Ga0070696_100048223 3300005546 Bacteria 2956
53 Ga0070696_100209933 3300005546 Unclassified 1457
54 Ga0070696_100296835 3300005546 Unclassified 1236
55 Ga0070704_100078863 3300005549 Bacteria 2417
56 Ga0068859_100452474 3300005617 Unclassified 1380
57 Ga0068862_100015155 3300005844 Bacteria 6402
58 Ga0070716_100000011 3300006173 Bacteria 143884
59 Ga0097621_100001283 3300006237 Bacteria 17273
60 Ga0075428_100710765 3300006844 Unclassified 1070
61 Ga0075431_100177507 3300006847 Unclassified 2187
62 Ga0075433_10362720 3300006852 Bacteria 1280
63 Ga0075434_100443671 3300006871 Bacteria 1319
64 Ga0075434_100865072 3300006871 Bacteria 919
65 Ga0097620_100452458 3300006931 Unclassified 1380
66 Ga0099794_10004777 3300007265 Bacteria 5373
67 Ga0105250_10069382 3300009092 Bacteria 1423
68 Ga0111539_10000227 3300009094 Bacteria 67567
69 Ga0105247_10126730 3300009101 Bacteria 1660
70 Ga0114129_10006354 3300009147 Bacteria 16753
71 Ga0114129_10089176 3300009147 Bacteria 4275
72 Ga0114129_10326066 3300009147 Unclassified 2040
73 Ga0114129_10365603 3300009147 Bacteria 1908
74 Ga0105243_10287197 3300009148 Bacteria 1485
75 Ga0105242_10016456 3300009176 Bacteria 5749
76 Ga0105242_10460040 3300009176 Bacteria 1201
77 Ga0105242_10471178 3300009176 Bacteria 1188
78 Ga0105248_10102631 3300009177 Bacteria 3223
79 Ga0105249_10000484 3300009553 Bacteria 36999
80 Ga0105249_10006583 3300009553 Bacteria 10108
81 Ga0105249_10035863 3300009553 Unclassified 4497
82 Ga0105249_10168850 3300009553 Unclassified 2120
83 Ga0105246_10040547 3300011119 Unclassified 3143
84 Ga0157373_10003543 3300013100 Bacteria 11791
85 Ga0157378_10142978 3300013297 Bacteria 2223
86 Ga0157378_10341964 3300013297 Bacteria 1459
87 Ga0163162_10000047 3300013306 Bacteria 123541
88 Ga0163162_10016882 3300013306 Bacteria 7137
89 Ga0163162_10049330 3300013306 Bacteria 4219
90 Ga0163162_10275234 3300013306 Unclassified 1815
91 Ga0157375_10313508 3300013308 Bacteria 1733
92 Ga0157375_10670622 3300013308 Bacteria 1192
93 Ga0163163_10146809 3300014325 Bacteria 2403
94 Ga0163163_10415368 3300014325 Bacteria 1404
95 Ga0157380_10005187 3300014326 Bacteria 9105
96 Ga0157380_10006099 3300014326 Bacteria 8447
97 Ga0157380_10134924 3300014326 Unclassified 2111
98 Ga0157380_10323664 3300014326 Unclassified 1430
99 Ga0207653_10034836 3300025885 Unclassified 1636
100 Ga0207685_10000019 3300025905 Bacteria 145568
101 Ga0207643_10033191 3300025908 Unclassified 2888
102 Ga0207684_10011480 3300025910 Bacteria 7745
103 Ga0207684_10021743 3300025910 Bacteria 5477
104 Ga0207684_10069761 3300025910 Unclassified 2987
105 Ga0207684_10084659 3300025910 Bacteria 2701
106 Ga0207684_10160579 3300025910 Unclassified 1935
107 Ga0207646_10027985 3300025922 Bacteria 5136
108 Ga0207681_10000306 3300025923 Bacteria 36019
109 Ga0207681_10006079 3300025923 Bacteria 7404
110 Ga0207681_10160537 3300025923 Unclassified 1694
111 Ga0207650_10062975 3300025925 Bacteria 2772
112 Ga0207650_10237292 3300025925 Unclassified 1473
113 Ga0207659_10121054 3300025926 Unclassified 2006
114 Ga0207687_10249267 3300025927 Bacteria 1411
115 Ga0207706_10294386 3300025933 Bacteria 1415
116 Ga0207686_10000778 3300025934 Bacteria 19589
117 Ga0207686_10317561 3300025934 Bacteria 1163
118 Ga0207665_10000057 3300025939 Bacteria 73138
119 Ga0207711_10084426 3300025941 Bacteria 2779
120 Ga0207689_10018089 3300025942 Bacteria 5951
121 Ga0207689_10146462 3300025942 Unclassified 1946
122 Ga0207689_10175037 3300025942 Bacteria 1769
123 Ga0207651_10001718 3300025960 Bacteria 10115
124 Ga0207651_10061481 3300025960 Unclassified 2613
125 Ga0207712_10003313 3300025961 Bacteria 10205
126 Ga0207712_10003787 3300025961 Bacteria 9548
127 Ga0207712_10146784 3300025961 Unclassified 1817
128 Ga0207668_10008992 3300025972 Bacteria 5972
129 Ga0207708_10086070 3300026075 Unclassified 2418
130 Ga0207708_10127836 3300026075 Bacteria 1984
131 Ga0207641_10124235 3300026088 Bacteria 2308
132 Ga0207674_10229967 3300026116 Bacteria 1802
133 Ga0207674_10427252 3300026116 Bacteria 1280
134 Ga0209588_1005394 3300027671 Bacteria 3665
135 Ga0207428_10009386 3300027907 Bacteria 8776
136 Ga0268264_10099607 3300028381 Bacteria 2522
137 Ga0307513_10000792 3300031456 Bacteria 45967
138 Ga0307406_10391357 3300031901 Bacteria 1099
139 Ga0373951_0008105 3300035091 Bacteria 2381
140 Ga0436365_0350389 3300039437 Bacteria 3217
141 Ga0451576_0925046 3300045051 Bacteria 915
142 Ga0495663_0000068 3300046525 Bacteria 47393
143 Ga0495621_0000355 3300046539 Bacteria 11151
144 Ga0495672_0020132 3300047320 Unclassified 4380
145 Ga0501074_0287838 3300049590 Bacteria 1168
146 Ga0501075_0199609 3300049591 Unclassified 1526
147 nmdc:mga05p37_190651_c1 3300050507 Bacteria 2489
148 nmdc:mga05p37_87186_c1 3300050507 Bacteria 3847
149 nmdc:mga05p37_955174_c1 3300050507 Unclassified 917
150 nmdc:mga06r32_410239_c1 3300050510 Unclassified 1336
151 nmdc:mga08y16_29006_c1 3300050511 Bacteria 5833
152 nmdc:mga0n895_591327_c1 3300050512 Bacteria 1113
153 nmdc:mga0a205_187543_c1 3300050515 Unclassified 1960
154 Ga0070696_100184521
155 SwRhRL2b_contig_2396006
156 LJNas_1005973
157 Ga0065715_10111263
158 Ga0065715_10242745
159 Ga0065707_10096682
160 Ga0065707_10161241
161 Ga0070690_100015716
162 Ga0070690_100054458
163 Ga0070670_100008536
164 Ga0070670_100116179
165 Ga0068869_100012749
166 Ga0068869_100204621
167 Ga0070666_10141738
168 Ga0070680_100261265
169 Ga0070682_100005007
170 Ga0070689_100036175
171 Ga0070668_100012907
172 Ga0070669_100003156
173 Ga0070669_100059107
174 Ga0070673_100013168
175 Ga0070673_100146451
176 Ga0070673_100270185
177 Ga0070703_10053211
178 Ga0070705_100035424
179 Ga0070700_100108769
180 Ga0070700_100347220
181 Ga0070694_100015351
182 Ga0070708_100000123
183 Ga0070662_100306602
184 Ga0070681_10627647
185 Ga0070706_100008396
186 Ga0070706_100011966
187 Ga0070706_100110475
188 Ga0070706_100530366
189 Ga0070707_100006719
190 Ga0070707_100187245
191 Ga0070707_100385445
192 Ga0070698_100002252
193 Ga0070698_100008896
194 Ga0070698_100016061
195 Ga0070699_100001087
196 Ga0070699_100043447
197 Ga0070699_100167245
198 Ga0070697_100000395
199 Ga0070697_100022993
200 Ga0070697_100024678
201 Ga0070686_100015204
202 Ga0070686_100056274
203 Ga0070686_100145800
204 Ga0070695_100133219
205 Ga0070696_100048223
206 Ga0070696_100209933
207 Ga0070696_100296835
208 Ga0070704_100078863
209 Ga0068859_100452474
210 Ga0068862_100015155
211 Ga0070716_100000011
212 Ga0097621_100001283
213 Ga0075428_100710765
214 Ga0075431_100177507
215 Ga0075433_10362720
216 Ga0075434_100443671
217 Ga0075434_100865072
218 Ga0097620_100452458
219 Ga0099794_10004777
220 Ga0105250_10069382
221 Ga0111539_10000227
222 Ga0105247_10126730
223 Ga0114129_10006354
224 Ga0114129_10089176
225 Ga0114129_10326066
226 Ga0114129_10365603
227 Ga0105243_10287197
228 Ga0105242_10016456
229 Ga0105242_10460040
230 Ga0105242_10471178
231 Ga0105248_10102631
232 Ga0105249_10000484
233 Ga0105249_10006583
234 Ga0105249_10035863
235 Ga0105249_10168850
236 Ga0105246_10040547
237 Ga0157373_10003543
238 Ga0157378_10142978
239 Ga0157378_10341964
240 Ga0163162_10000047
241 Ga0163162_10016882
242 Ga0163162_10049330
243 Ga0163162_10275234
244 Ga0157375_10313508
245 Ga0157375_10670622
246 Ga0163163_10146809
247 Ga0163163_10415368
248 Ga0157380_10005187
249 Ga0157380_10006099
250 Ga0157380_10134924
251 Ga0157380_10323664
252 Ga0207653_10034836
253 Ga0207685_10000019
254 Ga0207643_10033191
255 Ga0207684_10011480
256 Ga0207684_10021743
257 Ga0207684_10069761
258 Ga0207684_10084659
259 Ga0207684_10160579
260 Ga0207646_10027985
261 Ga0207681_10000306
262 Ga0207681_10006079
263 Ga0207681_10160537
264 Ga0207650_10062975
265 Ga0207650_10237292
266 Ga0207659_10121054
267 Ga0207687_10249267
268 Ga0207706_10294386
269 Ga0207686_10000778
270 Ga0207686_10317561
271 Ga0207665_10000057
272 Ga0207711_10084426
273 Ga0207689_10018089
274 Ga0207689_10146462
275 Ga0207689_10175037
276 Ga0207651_10001718
277 Ga0207651_10061481
278 Ga0207712_10003313
279 Ga0207712_10003787
280 Ga0207712_10146784
281 Ga0207668_10008992
282 Ga0207708_10086070
283 Ga0207708_10127836
284 Ga0207641_10124235
285 Ga0207674_10229967
286 Ga0207674_10427252
287 Ga0209588_1005394
288 Ga0207428_10009386
289 Ga0268264_10099607
290 Ga0307513_10000792
291 Ga0307406_10391357
292 Ga0373951_0008105
293 Ga0436365_0350389
294 Ga0451576_0925046
295 Ga0495663_0000068
296 Ga0495621_0000355
297 Ga0495672_0020132
298 Ga0501074_0287838
299 Ga0501075_0199609
300 nmdc:mga05p37_190651_c1
301 nmdc:mga05p37_87186_c1
302 nmdc:mga05p37_955174_c1
303 nmdc:mga06r32_410239_c1
304 nmdc:mga08y16_29006_c1
305 nmdc:mga0n895_591327_c1
306 nmdc:mga0a205_187543_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

31

241

0.87

PF04321

RmlD_sub_bind

RmlD substrate binding domain

29

287

0.8

PF07993

NAD_binding_4

Male sterility protein

60

224

0.8

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

59

307

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wok-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad 0.8645 2 277
2hun-assembly1.cif.gz_B crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3 0.8598 1 278
2hun-assembly1.cif.gz_B crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3 0.854 1 278
4wok-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad 0.8528 2 277
1kvq-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.8452 1 276
ID Description Score Start End Superfamily
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8653 2 278 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8597 102 278 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8565 2 278 3.40.50.720
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8371 66 278 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.837 1 278 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352FPB8-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9827 1 140
AF-A0A352FPB8-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9758 1 140
AF-A0A136KCF2-F1-model_v4 deleted 0.9643 1 215
AF-A0A7V8YYH7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9593 56 279
AF-A0A7V8YYH7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9511 56 279

Map