F215517

General Info

Members Datasets Scaffolds Average Seq Length
152 102 144 137

Family's Representative Sequence

Representative Sequence 3300049762|Ga0501265_046312|Ga0501265_046312_189_659
Length 156
Sequence MNQLKFVLTGTFFGIVMAKSEAISWYRIQEMFRFQSFHMYGIIGTAVVLGVVAVYLIKKFNIRDTEGHAIDFPDKDRTWKKYLIGGSIFGLGWALTGACPGPMFVNVGYGYLAMLIVILGALLGTYLYGVLQRKLPHQQRKELFSSCKRQKPRYTR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
5 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
56 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
80 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
91 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
92 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
93 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
96 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
97 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
100 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
101 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
102 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 0.66
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1065068 2162886007 Bacteria 22643
2 SwRhRL2b_contig_1126829 2162886007 Bacteria 10951
3 SwRhRL2b_contig_3435431 2162886007 Bacteria 2580
4 JGI24737J22298_10031704 3300001990 Bacteria 1649
5 JGI24735J21928_10011309 3300002067 Unclassified 2833
6 rootH1_10284823 3300003323 Bacteria 4943
7 Ga0055531_10000071 3300003794 Bacteria 110534
8 Ga0065714_10002228 3300005288 Bacteria 43581
9 Ga0065714_10002586 3300005288 Bacteria 26138
10 Ga0065704_10000215 3300005289 Bacteria 98472
11 Ga0065704_10000252 3300005289 Bacteria 51507
12 Ga0065704_10078971 3300005289 Bacteria 4290
13 Ga0065707_10155176 3300005295 Bacteria 1604
14 Ga0068868_100458055 3300005338 Bacteria 1110
15 Ga0070673_100163590 3300005364 Bacteria 1894
16 Ga0070659_100001172 3300005366 Bacteria 19121
17 Ga0070659_100030903 3300005366 Bacteria 4146
18 Ga0070663_100003140 3300005455 Bacteria 9470
19 Ga0070663_100036683 3300005455 Unclassified 3407
20 Ga0070662_100000003 3300005457 Bacteria 239813
21 Ga0068854_100796692 3300005578 Bacteria 823
22 Ga0068858_101912674 3300005842 Bacteria 586
23 Ga0075365_10024560 3300006038 Bacteria 3803
24 Ga0075366_10000038 3300006195 Bacteria 46485
25 Ga0097621_101200811 3300006237 Bacteria 714
26 Ga0105240_10037465 3300009093 Bacteria 6233
27 Ga0105241_10003954 3300009174 Bacteria 10962
28 Ga0105239_10656739 3300010375 Bacteria 1198
29 Ga0105246_10020904 3300011119 Bacteria 4203
30 Ga0157373_10000366 3300013100 Bacteria 36257
31 Ga0157373_10003091 3300013100 Bacteria 12574
32 Ga0157373_10064282 3300013100 Bacteria 2598
33 Ga0157373_10088343 3300013100 Bacteria 2183
34 Ga0157371_10000363 3300013102 Bacteria 57446
35 Ga0157371_10000707 3300013102 Bacteria 39149
36 Ga0157371_10007259 3300013102 Bacteria 9002
37 Ga0157371_10138816 3300013102 Bacteria 1731
38 Ga0157371_10202719 3300013102 Bacteria 1422
39 Ga0157370_10000332 3300013104 Bacteria 59335
40 Ga0157370_10000808 3300013104 Bacteria 39533
41 Ga0157370_10007411 3300013104 Bacteria 11945
42 Ga0157370_10030733 3300013104 Bacteria 5261
43 Ga0157370_10050859 3300013104 Bacteria 3959
44 Ga0157370_10119606 3300013104 Bacteria 2459
45 Ga0157369_10000393 3300013105 Bacteria 58167
46 Ga0157369_10114932 3300013105 Bacteria 2858
47 Ga0157369_10497546 3300013105 Bacteria 1261
48 Ga0157369_10862427 3300013105 Unclassified 929
49 Ga0157374_10003055 3300013296 Bacteria 14034
50 Ga0157372_10000034 3300013307 Bacteria 174784
51 Ga0157372_10001149 3300013307 Bacteria 28728
52 Ga0157372_10036240 3300013307 Bacteria 5436
53 Ga0157372_10165032 3300013307 Bacteria 2561
54 Ga0157375_10221212 3300013308 Bacteria 2052
55 Ga0182008_10000012 3300014497 Bacteria 297475
56 Ga0182008_10004834 3300014497 Bacteria 7786
57 Ga0182008_10170364 3300014497 Unclassified 1099
58 Ga0157377_10020861 3300014745 Bacteria 3438
59 Ga0157376_10197620 3300014969 Unclassified 1848
60 Ga0182006_1002971 3300015261 Bacteria 8942
61 Ga0182006_1200776 3300015261 Bacteria 661
62 Ga0182007_10011343 3300015262 Bacteria 3471
63 Ga0182007_10046902 3300015262 Bacteria 1430
64 Ga0182007_10091634 3300015262 Unclassified 1001
65 Ga0209563_114208 3300025230 Bacteria 1028
66 Ga0209233_1004705 3300025261 Bacteria 4601
67 Ga0209257_1000001 3300025304 Bacteria 2274655
68 Ga0207647_10000049 3300025904 Bacteria 88392
69 Ga0207654_10004578 3300025911 Bacteria 6983
70 Ga0207695_10006474 3300025913 Bacteria 15201
71 Ga0207690_10013520 3300025932 Bacteria 4905
72 Ga0207706_10000111 3300025933 Bacteria 87282
73 Ga0207665_10215536 3300025939 Bacteria 1405
74 Ga0207677_10427277 3300026023 Bacteria 1130
75 Ga0207678_10013405 3300026067 Bacteria 7195
76 Ga0207678_10094239 3300026067 Unclassified 2558
77 Ga0307515_10000528 3300028794 Bacteria 90438
78 Ga0316183_1205351 3300030742 Unclassified 960
79 Ga0316181_1050796 3300030744 Unclassified 693
80 Ga0307408_100001220 3300031548 Bacteria 19358
81 Ga0307408_100001405 3300031548 Bacteria 17924
82 Ga0307408_100005015 3300031548 Bacteria 8882
83 Ga0307405_10166776 3300031731 Bacteria 1566
84 Ga0307412_10000001 3300031911 Bacteria 822691
85 Ga0307412_10234500 3300031911 Bacteria 1415
86 Ga0307416_101391137 3300032002 Bacteria 807
87 Ga0307414_10000131 3300032004 Bacteria 51831
88 Ga0307414_10001846 3300032004 Bacteria 10959
89 Ga0307414_10003414 3300032004 Bacteria 8480
90 Ga0307414_10006995 3300032004 Bacteria 6323
91 Ga0307414_10025125 3300032004 Bacteria 3809
92 Ga0307414_10025714 3300032004 Bacteria 3776
93 Ga0307414_10031323 3300032004 Bacteria 3487
94 Ga0307414_10056696 3300032004 Bacteria 2750
95 Ga0307414_10080103 3300032004 Bacteria 2387
96 Ga0307414_10146196 3300032004 Bacteria 1858
97 Ga0307414_10309766 3300032004 Unclassified 1340
98 Ga0307414_10435107 3300032004 Bacteria 1147
99 Ga0307414_10620159 3300032004 Bacteria 972
100 Ga0307414_10892184 3300032004 Bacteria 815
101 Ga0307414_11284434 3300032004 Bacteria 679
102 Ga0307414_11629780 3300032004 Bacteria 601
103 Ga0307411_10019980 3300032005 Bacteria 3884
104 Ga0307415_100619848 3300032126 Bacteria 966
105 Ga0307507_10000159 3300033179 Bacteria 120125
106 Ga0395899_0000182 3300037312 Bacteria 92470
107 Ga0395900_0223466 3300037418 Bacteria 1897
108 Ga0439440_0090292 3300042993 Bacteria 821
109 Ga0466969_0073631 3300044656 Bacteria 1639
110 Ga0466966_0575874 3300044684 Bacteria 677
111 Ga0466961_0012868 3300044693 Bacteria 5353
112 Ga0495627_096273 3300046453 Bacteria 848
113 Ga0495629_0258021 3300046459 Bacteria 1198
114 Ga0495585_0004574 3300046492 Bacteria 8945
115 Ga0495607_0359821 3300046501 Bacteria 670
116 Ga0495620_0084618 3300046515 Bacteria 1279
117 Ga0495628_0645713 3300046516 Bacteria 752
118 Ga0495630_0465383 3300046517 Bacteria 969
119 Ga0495631_0417860 3300046518 Bacteria 571
120 Ga0495609_0001764 3300046538 Bacteria 13889
121 Ga0495633_0000074 3300046558 Bacteria 130197
122 Ga0495668_0000017 3300046616 Bacteria 434025
123 Ga0495625_0004046 3300046660 Bacteria 14017
124 Ga0495625_0005747 3300046660 Bacteria 11215
125 Ga0495661_0276037 3300046665 Bacteria 849
126 Ga0495660_0061346 3300046810 Bacteria 2018
127 Ga0495614_0064016 3300048089 Bacteria 1581
128 Ga0496104_0108725 3300048907 Unclassified 2658
129 Ga0496126_0016653 3300048929 Bacteria 7346
130 Ga0495682_0069325 3300049460 Bacteria 1269
131 Ga0501073_0797288 3300049589 Bacteria 651
132 Ga0501198_027182 3300049649 Unclassified 938
133 Ga0501223_000280 3300049663 Bacteria 12804
134 Ga0501242_024395 3300049674 Bacteria 792
135 Ga0501250_107112 3300049680 Bacteria 504
136 Ga0501080_0280453 3300049742 Unclassified 1515
137 Ga0501241_017016 3300049758 Bacteria 1328
138 Ga0501263_019699 3300049760 Bacteria 901
139 Ga0501265_046312 3300049762 Bacteria 672
140 nmdc:mga0k408_50_c1 3300050493 Bacteria 59317
141 Ga0500578_0491452 3300053086 Bacteria 692
142 Ga0500651_0180831 3300053093 Bacteria 1252
143 Ga0500562_012061 3300053108 Bacteria 2195
144 Ga0500568_0038123 3300053139 Bacteria 1947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049760 Ga0501263_019699 Ga0501263_019699_35_448 129
2 3300046516 Ga0495628_0645713 Ga0495628_0645713_277_741 131
3 iso_pu_bacteria 2738543023 2739304101 133
4 iso_pu_bacteria 2775506987 2776614266 133
5 iso_pu_bacteria 2839989709 2839990977 133
6 iso_pu_bacteria 2852623160 2852624484 133
7 iso_pu_bacteria 2884933994 2884936631 133
8 iso_pu_bacteria 2910245624 2910248024 133
9 iso_pu_bacteria 2738541284 2738761661 134
10 iso_pu_bacteria 2852627209 2852630175 134
11 3300042993 Ga0439440_0090292 Ga0439440_0090292_394_810 136
12 2162886007 SwRhRL2b_contig_1065068 SwRhRL2b_0440.00003570 137
13 2162886007 SwRhRL2b_contig_1126829 SwRhRL2b_0825.00006150 137
14 2162886007 SwRhRL2b_contig_3435431 SwRhRL2b_0846.00004080 137
15 3300001990 JGI24737J22298_10031704 JGI24737J22298_100317043 137
16 3300002067 JGI24735J21928_10011309 JGI24735J21928_100113093 137
17 3300003323 rootH1_10284823 rootH1_102848231 137
18 3300003794 Ga0055531_10000071 Ga0055531_1000007137 137
19 3300005288 Ga0065714_10002228 Ga0065714_1000222814 137
20 3300005288 Ga0065714_10002586 Ga0065714_1000258622 137
21 3300005289 Ga0065704_10000215 Ga0065704_1000021525 137
22 3300005289 Ga0065704_10000252 Ga0065704_1000025218 137
23 3300005289 Ga0065704_10078971 Ga0065704_100789712 137
24 3300005295 Ga0065707_10155176 Ga0065707_101551762 137
25 3300005338 Ga0068868_100458055 Ga0068868_1004580552 137
26 3300005364 Ga0070673_100163590 Ga0070673_1001635902 137
27 3300005366 Ga0070659_100001172 Ga0070659_1000011723 137
28 3300005366 Ga0070659_100030903 Ga0070659_1000309032 137
29 3300005455 Ga0070663_100003140 Ga0070663_1000031406 137
30 3300005455 Ga0070663_100036683 Ga0070663_1000366833 137
31 3300005457 Ga0070662_100000003 Ga0070662_100000003202 137
32 3300005578 Ga0068854_100796692 Ga0068854_1007966922 137
33 3300005842 Ga0068858_101912674 Ga0068858_1019126741 137
34 3300006038 Ga0075365_10024560 Ga0075365_100245602 137
35 3300006195 Ga0075366_10000038 Ga0075366_1000003832 137
36 3300006237 Ga0097621_101200811 Ga0097621_1012008112 137
37 3300009093 Ga0105240_10037465 Ga0105240_100374653 137
38 3300009174 Ga0105241_10003954 Ga0105241_100039543 137
39 3300010375 Ga0105239_10656739 Ga0105239_106567392 137
40 3300011119 Ga0105246_10020904 Ga0105246_100209044 137
41 3300013100 Ga0157373_10000366 Ga0157373_1000036611 137
42 3300013100 Ga0157373_10003091 Ga0157373_100030912 137
43 3300013100 Ga0157373_10064282 Ga0157373_100642823 137
44 3300013100 Ga0157373_10088343 Ga0157373_100883432 137
45 3300013102 Ga0157371_10000363 Ga0157371_1000036328 137
46 3300013102 Ga0157371_10000707 Ga0157371_1000070717 137
47 3300013102 Ga0157371_10007259 Ga0157371_100072598 137
48 3300013102 Ga0157371_10138816 Ga0157371_101388163 137
49 3300013102 Ga0157371_10202719 Ga0157371_102027192 137
50 3300013104 Ga0157370_10000332 Ga0157370_1000033232 137
51 3300013104 Ga0157370_10000808 Ga0157370_1000080833 137
52 3300013104 Ga0157370_10007411 Ga0157370_100074119 137
53 3300013104 Ga0157370_10030733 Ga0157370_100307333 137
54 3300013104 Ga0157370_10050859 Ga0157370_100508593 137
55 3300013104 Ga0157370_10119606 Ga0157370_101196061 137
56 3300013105 Ga0157369_10000393 Ga0157369_1000039338 137
57 3300013105 Ga0157369_10114932 Ga0157369_101149322 137
58 3300013105 Ga0157369_10497546 Ga0157369_104975462 137
59 3300013105 Ga0157369_10862427 Ga0157369_108624272 137
60 3300013296 Ga0157374_10003055 Ga0157374_100030558 137
61 3300013307 Ga0157372_10000034 Ga0157372_10000034136 137
62 3300013307 Ga0157372_10001149 Ga0157372_100011498 137
63 3300013307 Ga0157372_10036240 Ga0157372_100362407 137
64 3300013307 Ga0157372_10165032 Ga0157372_101650323 137
65 3300013308 Ga0157375_10221212 Ga0157375_102212121 137
66 3300014497 Ga0182008_10000012 Ga0182008_10000012100 137
67 3300014497 Ga0182008_10004834 Ga0182008_100048345 137
68 3300014497 Ga0182008_10170364 Ga0182008_101703642 137
69 3300014745 Ga0157377_10020861 Ga0157377_100208613 137
70 3300014969 Ga0157376_10197620 Ga0157376_101976202 137
71 3300015261 Ga0182006_1002971 Ga0182006_10029713 137
72 3300015261 Ga0182006_1200776 Ga0182006_12007761 137
73 3300015262 Ga0182007_10011343 Ga0182007_100113433 137
74 3300015262 Ga0182007_10046902 Ga0182007_100469022 137
75 3300015262 Ga0182007_10091634 Ga0182007_100916342 137
76 3300025230 Ga0209563_114208 Ga0209563_1142082 137
77 3300025261 Ga0209233_1004705 Ga0209233_10047053 137
78 3300025304 Ga0209257_1000001 Ga0209257_1000001601 137
79 3300025904 Ga0207647_10000049 Ga0207647_1000004917 137
80 3300025911 Ga0207654_10004578 Ga0207654_100045783 137
81 3300025913 Ga0207695_10006474 Ga0207695_100064746 137
82 3300025932 Ga0207690_10013520 Ga0207690_100135203 137
83 3300025933 Ga0207706_10000111 Ga0207706_1000011116 137
84 3300025939 Ga0207665_10215536 Ga0207665_102155363 137
85 3300026023 Ga0207677_10427277 Ga0207677_104272772 137
86 3300026067 Ga0207678_10013405 Ga0207678_100134054 137
87 3300026067 Ga0207678_10094239 Ga0207678_100942392 137
88 3300028794 Ga0307515_10000528 Ga0307515_1000052836 137
89 3300030742 Ga0316183_1205351 Ga0316183_12053512 137
90 3300030744 Ga0316181_1050796 Ga0316181_10507962 137
91 3300031548 Ga0307408_100001220 Ga0307408_10000122017 137
92 3300031548 Ga0307408_100001405 Ga0307408_10000140514 137
93 3300031548 Ga0307408_100005015 Ga0307408_1000050156 137
94 3300031731 Ga0307405_10166776 Ga0307405_101667762 137
95 3300031911 Ga0307412_10000001 Ga0307412_10000001667 137
96 3300031911 Ga0307412_10234500 Ga0307412_102345002 137
97 3300032002 Ga0307416_101391137 Ga0307416_1013911371 137
98 3300032004 Ga0307414_10000131 Ga0307414_1000013110 137
99 3300032004 Ga0307414_10001846 Ga0307414_100018468 137
100 3300032004 Ga0307414_10003414 Ga0307414_100034146 137
101 3300032004 Ga0307414_10006995 Ga0307414_100069957 137
102 3300032004 Ga0307414_10025125 Ga0307414_100251255 137
103 3300032004 Ga0307414_10025714 Ga0307414_100257143 137
104 3300032004 Ga0307414_10031323 Ga0307414_100313232 137
105 3300032004 Ga0307414_10056696 Ga0307414_100566961 137
106 3300032004 Ga0307414_10080103 Ga0307414_100801031 137
107 3300032004 Ga0307414_10146196 Ga0307414_101461963 137
108 3300032004 Ga0307414_10309766 Ga0307414_103097661 137
109 3300032004 Ga0307414_10435107 Ga0307414_104351072 137
110 3300032004 Ga0307414_10620159 Ga0307414_106201591 137
111 3300032004 Ga0307414_10892184 Ga0307414_108921842 137
112 3300032004 Ga0307414_11284434 Ga0307414_112844341 137
113 3300032004 Ga0307414_11629780 Ga0307414_116297802 137
114 3300032005 Ga0307411_10019980 Ga0307411_100199803 137
115 3300032126 Ga0307415_100619848 Ga0307415_1006198482 137
116 3300033179 Ga0307507_10000159 Ga0307507_1000015996 137
117 3300037312 Ga0395899_0000182 Ga0395899_0000182_62437_62850 137
118 3300037418 Ga0395900_0223466 Ga0395900_0223466_527_940 137
119 3300044656 Ga0466969_0073631 Ga0466969_0073631_82_495 137
120 3300044684 Ga0466966_0575874 Ga0466966_0575874_83_496 137
121 3300044693 Ga0466961_0012868 Ga0466961_0012868_1984_2397 137
122 3300046453 Ga0495627_096273 Ga0495627_096273_380_793 137
123 3300046459 Ga0495629_0258021 Ga0495629_0258021_172_585 137
124 3300046492 Ga0495585_0004574 Ga0495585_0004574_2795_3208 137
125 3300046501 Ga0495607_0359821 Ga0495607_0359821_211_624 137
126 3300046515 Ga0495620_0084618 Ga0495620_0084618_810_1223 137
127 3300046517 Ga0495630_0465383 Ga0495630_0465383_48_461 137
128 3300046518 Ga0495631_0417860 Ga0495631_0417860_76_489 137
129 3300046538 Ga0495609_0001764 Ga0495609_0001764_9045_9458 137
130 3300046558 Ga0495633_0000074 Ga0495633_0000074_72998_73411 137
131 3300046616 Ga0495668_0000017 Ga0495668_0000017_292332_292745 137
132 3300046660 Ga0495625_0004046 Ga0495625_0004046_5601_6014 137
133 3300046660 Ga0495625_0005747 Ga0495625_0005747_7772_8185 137
134 3300046665 Ga0495661_0276037 Ga0495661_0276037_384_797 137
135 3300046810 Ga0495660_0061346 Ga0495660_0061346_946_1359 137
136 3300048089 Ga0495614_0064016 Ga0495614_0064016_443_856 137
137 3300048907 Ga0496104_0108725 Ga0496104_0108725_163_576 137
138 3300048929 Ga0496126_0016653 Ga0496126_0016653_2159_2575 137
139 3300049460 Ga0495682_0069325 Ga0495682_0069325_108_521 137
140 3300049589 Ga0501073_0797288 Ga0501073_0797288_22_438 137
141 3300049649 Ga0501198_027182 Ga0501198_027182_407_820 137
142 3300049663 Ga0501223_000280 Ga0501223_000280_6444_6857 137
143 3300049674 Ga0501242_024395 Ga0501242_024395_305_718 137
144 3300049680 Ga0501250_107112 Ga0501250_107112_37_450 137
145 3300049742 Ga0501080_0280453 Ga0501080_0280453_146_559 137
146 3300049758 Ga0501241_017016 Ga0501241_017016_566_982 137
147 3300049762 Ga0501265_046312 Ga0501265_046312_189_659 137
148 3300050493 nmdc:mga0k408_50_c1 nmdc:mga0k408_50_c1_36373_36786 137
149 3300053086 Ga0500578_0491452 Ga0500578_0491452_112_525 137
150 3300053093 Ga0500651_0180831 Ga0500651_0180831_398_814 137
151 3300053108 Ga0500562_012061 Ga0500562_012061_1399_1812 137
152 3300053139 Ga0500568_0038123 Ga0500568_0038123_1027_1443 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

1

142

0.86

PF04143

Sulf_transp

Sulphur transport

19

150

0.85

Feature Viewer

pLDDT pTM Quality
66.8 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map