F215159

General Info

Members Datasets Scaffolds Average Seq Length
152 127 304 180

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0051245|Ga0495603_0051245_679_1302
Length 207
Sequence MAAVEHKEPEMSTYCDIAPTHEWHGPYHANEYGFPLTSDADLLERLVLEINQAGLSWLTILKKREAFRKAYDGFDPEIVARYKARDRKRLLNDPGIIRNRLKVDAAIANAQKILELRKSHGGFHAWLKAHHPLTKEEWVKLFKQTFRFTGGEIVGEFLMSIGYLPGAHAASCPVYRKIAALEPAWMVQSQRHGEHRTDSDEKQTPCA

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
67 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
70 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
71 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
81 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
82 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
110 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
111 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
112 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
113 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
114 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
115 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
118 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
119 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2739367663 Pedobacter sp. YR510 Isolate Unclassified
126 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
127 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 0
Rhizoplane 6.58
Rhizosphere 80.26
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0051245 3300046455 Bacteria 2453
2 rootL2_10010008 3300003322 Bacteria 3554
3 Ga0055542_1006816 3300003762 Bacteria 2392
4 Ga0070683_100067506 3300005329 Bacteria 3331
5 Ga0070670_100064020 3300005331 Bacteria 3155
6 Ga0068868_100274019 3300005338 Bacteria 1426
7 Ga0070691_10041730 3300005341 Bacteria 2170
8 Ga0070703_10227501 3300005406 Bacteria 746
9 Ga0070694_100004774 3300005444 Bacteria 8162
10 Ga0070663_100310387 3300005455 Bacteria 1265
11 Ga0068867_100152603 3300005459 Bacteria 1816
12 Ga0070684_100015744 3300005535 Bacteria 6171
13 Ga0070697_100679302 3300005536 Bacteria 908
14 Ga0068853_100632843 3300005539 Bacteria 1017
15 Ga0070696_100059170 3300005546 Bacteria 2677
16 Ga0068855_100165499 3300005563 Bacteria 2507
17 Ga0068856_100478380 3300005614 Bacteria 1266
18 Ga0068852_100172237 3300005616 Bacteria 2030
19 Ga0068862_100129064 3300005844 Bacteria 2235
20 Ga0075430_100006324 3300006846 Bacteria 9990
21 Ga0075431_100035740 3300006847 Bacteria 5116
22 Ga0075433_10315625 3300006852 Bacteria 1383
23 Ga0105240_10003288 3300009093 Bacteria 25279
24 Ga0105240_10005823 3300009093 Bacteria 18282
25 Ga0114129_10539031 3300009147 Bacteria 1519
26 Ga0105243_10011998 3300009148 Bacteria 6551
27 Ga0105243_10595243 3300009148 Bacteria 1064
28 Ga0105241_10001970 3300009174 Bacteria 15546
29 Ga0105237_10098166 3300009545 Bacteria 2920
30 Ga0105238_10009684 3300009551 Bacteria 9646
31 Ga0105249_10122977 3300009553 Bacteria 2468
32 Ga0105239_10147707 3300010375 Bacteria 2623
33 Ga0105239_10152534 3300010375 Bacteria 2579
34 Ga0105239_10172895 3300010375 Bacteria 2416
35 Ga0105246_10006286 3300011119 Bacteria 7248
36 Ga0157373_10274590 3300013100 Bacteria 1194
37 Ga0157371_10328284 3300013102 Bacteria 1111
38 Ga0157370_10029695 3300013104 Bacteria 5362
39 Ga0157370_10567058 3300013104 Bacteria 1040
40 Ga0157370_11093307 3300013104 Bacteria 721
41 Ga0157369_10890814 3300013105 Unclassified 913
42 Ga0157378_10503695 3300013297 Bacteria 1210
43 Ga0163162_10480413 3300013306 Bacteria 1374
44 Ga0157372_10022181 3300013307 Bacteria 6868
45 Ga0157372_10074718 3300013307 Bacteria 3822
46 Ga0157372_10411816 3300013307 Bacteria 1575
47 Ga0157372_11780328 3300013307 Unclassified 708
48 Ga0157375_10927407 3300013308 Bacteria 1014
49 Ga0157380_10127103 3300014326 Bacteria 2168
50 Ga0157380_10776538 3300014326 Bacteria 972
51 Ga0182006_1023374 3300015261 Bacteria 2560
52 Ga0213873_10173546 3300021358 Unclassified 658
53 Ga0209258_100029 3300025242 Bacteria 490648
54 Ga0209148_1000163 3300025254 Bacteria 137449
55 Ga0209148_1000636 3300025254 Bacteria 30719
56 Ga0209455_1002662 3300025272 Bacteria 6729
57 Ga0207695_10000439 3300025913 Bacteria 91116
58 Ga0207662_10583265 3300025918 Bacteria 777
59 Ga0207650_10044965 3300025925 Bacteria 3247
60 Ga0207709_10000983 3300025935 Bacteria 21295
61 Ga0207691_10227076 3300025940 Bacteria 1617
62 Ga0207661_10024161 3300025944 Bacteria 4602
63 Ga0207661_10729447 3300025944 Bacteria 912
64 Ga0207667_10015548 3300025949 Bacteria 8637
65 Ga0207639_10411232 3300026041 Bacteria 1221
66 Ga0207639_10772430 3300026041 Bacteria 894
67 Ga0207698_10083028 3300026142 Bacteria 2592
68 Ga0307414_10014714 3300032004 Bacteria 4700
69 Ga0373923_0033456 3300035111 Bacteria 2082
70 Ga0373941_0061284 3300035115 Bacteria 1225
71 Ga0373953_0010138 3300035117 Bacteria 3266
72 Ga0373957_0024565 3300035120 Bacteria 2165
73 Ga0373933_0342667 3300035724 Bacteria 970
74 Ga0373937_0002849 3300036401 Bacteria 14447
75 Ga0316584_0035469 3300036712 Unclassified 3701
76 Ga0395900_0149162 3300037418 Bacteria 2390
77 Ga0395898_0666269 3300037466 Bacteria 983
78 Ga0436364_0115620 3300037853 Unclassified 1143
79 Ga0436364_0815200 3300037853 Bacteria 1367
80 Ga0242420_005833 3300038996 Bacteria 1927
81 Ga0436361_0832836 3300039447 Bacteria 1917
82 Ga0436362_0198274 3300039453 Bacteria 1479
83 Ga0439466_0044633 3300041411 Bacteria 1468
84 Ga0451793_0055941 3300041452 Bacteria 642
85 Ga0451807_0574335 3300041486 Bacteria 679
86 Ga0439449_0032466 3300042007 Bacteria 1946
87 Ga0451577_0321307 3300042876 Bacteria 1404
88 Ga0466957_0035214 3300044842 Bacteria 3004
89 Ga0451576_0165265 3300045051 Bacteria 2309
90 Ga0495590_0012345 3300046457 Bacteria 3171
91 Ga0495594_0197891 3300046499 Bacteria 1145
92 Ga0495594_0518301 3300046499 Bacteria 677
93 Ga0495667_0070071 3300046559 Bacteria 2288
94 Ga0495656_0015015 3300046615 Bacteria 2915
95 Ga0495635_0406507 3300046663 Bacteria 904
96 Ga0495636_0008323 3300047318 Bacteria 4094
97 Ga0495636_0057577 3300047318 Bacteria 1637
98 Ga0495687_000135 3300047443 Bacteria 113460
99 Ga0496102_0448456 3300048905 Bacteria 1210
100 Ga0496104_0108796 3300048907 Bacteria 2657
101 Ga0496106_0186970 3300048909 Bacteria 1646
102 Ga0496109_0002317 3300048912 Bacteria 15854
103 Ga0496110_0026198 3300048913 Bacteria 4987
104 Ga0496112_0307482 3300048915 Bacteria 1530
105 Ga0496113_0144038 3300048916 Bacteria 1876
106 Ga0496113_0413641 3300048916 Bacteria 1083
107 Ga0496126_0054285 3300048929 Bacteria 3630
108 Ga0501290_035004 3300049513 Bacteria 733
109 Ga0501034_0056104 3300049571 Bacteria 3965
110 Ga0501036_0630486 3300049572 Bacteria 888
111 Ga0501040_0150751 3300049576 Bacteria 1640
112 Ga0501040_0404037 3300049576 Bacteria 981
113 Ga0501041_0308022 3300049577 Bacteria 998
114 Ga0501046_0456186 3300049580 Bacteria 919
115 Ga0501047_0037627 3300049581 Bacteria 4679
116 Ga0501047_0190531 3300049581 Bacteria 1914
117 Ga0501048_0185197 3300049582 Bacteria 1476
118 Ga0501073_0107580 3300049589 Bacteria 1935
119 Ga0501073_0525082 3300049589 Bacteria 818
120 Ga0501074_0199260 3300049590 Bacteria 1427
121 Ga0501074_0283316 3300049590 Bacteria 1178
122 Ga0501075_0218991 3300049591 Bacteria 1452
123 Ga0501076_0435496 3300049592 Bacteria 1079
124 Ga0501077_0281045 3300049593 Bacteria 1059
125 Ga0501079_0186019 3300049741 Bacteria 1621
126 Ga0501079_0248788 3300049741 Bacteria 1389
127 Ga0501275_000951 3300049772 Bacteria 3063
128 Ga0501035_1028035 3300049822 Bacteria 647
129 Ga0501044_0003566 3300049823 Bacteria 17507
130 Ga0501045_0123898 3300049824 Bacteria 1919
131 Ga0501045_0257167 3300049824 Bacteria 1300
132 Ga0501045_0645514 3300049824 Bacteria 782
133 Ga0495595_0221441 3300053084 Bacteria 944
134 Ga0495619_0228700 3300053085 Bacteria 1288
135 Ga0500578_0031296 3300053086 Bacteria 3419
136 Ga0500644_0064303 3300053088 Unclassified 1303
137 Ga0500642_0128053 3300053130 Bacteria 1189
138 Ga0500559_0224557 3300053136 Bacteria 885
139 Ga0500561_0039282 3300053137 Bacteria 1241
140 Ga0500616_0022448 3300053153 Bacteria 3522
141 Ga0500633_0001116 3300053160 Bacteria 4835
142 Ga0500636_0239185 3300053177 Bacteria 934
143 Ga0500637_0408376 3300053178 Bacteria 703
144 Ga0501084_0133267 3300054114 Bacteria 2092
145 Ga0590075_048956 3300059424 Bacteria 1084
146 Ga0590077_051160 3300059426 Bacteria 927
147 Ga0501082_0118344 3300060353 Bacteria 2295
148 Ga0501082_0174980 3300060353 Bacteria 1866
149 Ga0530510_0144096 3300061734 Bacteria 1757
150 2739646019 2739367663 Bacteria 5040914
151 2842088138 2842083920 Bacteria 4857652
152 2919512435 2919509842 Bacteria 4104664
153 Ga0495603_0051245
154 rootL2_10010008
155 Ga0055542_1006816
156 Ga0070683_100067506
157 Ga0070670_100064020
158 Ga0068868_100274019
159 Ga0070691_10041730
160 Ga0070703_10227501
161 Ga0070694_100004774
162 Ga0070663_100310387
163 Ga0068867_100152603
164 Ga0070684_100015744
165 Ga0070697_100679302
166 Ga0068853_100632843
167 Ga0070696_100059170
168 Ga0068855_100165499
169 Ga0068856_100478380
170 Ga0068852_100172237
171 Ga0068862_100129064
172 Ga0075430_100006324
173 Ga0075431_100035740
174 Ga0075433_10315625
175 Ga0105240_10003288
176 Ga0105240_10005823
177 Ga0114129_10539031
178 Ga0105243_10011998
179 Ga0105243_10595243
180 Ga0105241_10001970
181 Ga0105237_10098166
182 Ga0105238_10009684
183 Ga0105249_10122977
184 Ga0105239_10147707
185 Ga0105239_10152534
186 Ga0105239_10172895
187 Ga0105246_10006286
188 Ga0157373_10274590
189 Ga0157371_10328284
190 Ga0157370_10029695
191 Ga0157370_10567058
192 Ga0157370_11093307
193 Ga0157369_10890814
194 Ga0157378_10503695
195 Ga0163162_10480413
196 Ga0157372_10022181
197 Ga0157372_10074718
198 Ga0157372_10411816
199 Ga0157372_11780328
200 Ga0157375_10927407
201 Ga0157380_10127103
202 Ga0157380_10776538
203 Ga0182006_1023374
204 Ga0213873_10173546
205 Ga0209258_100029
206 Ga0209148_1000163
207 Ga0209148_1000636
208 Ga0209455_1002662
209 Ga0207695_10000439
210 Ga0207662_10583265
211 Ga0207650_10044965
212 Ga0207709_10000983
213 Ga0207691_10227076
214 Ga0207661_10024161
215 Ga0207661_10729447
216 Ga0207667_10015548
217 Ga0207639_10411232
218 Ga0207639_10772430
219 Ga0207698_10083028
220 Ga0307414_10014714
221 Ga0373923_0033456
222 Ga0373941_0061284
223 Ga0373953_0010138
224 Ga0373957_0024565
225 Ga0373933_0342667
226 Ga0373937_0002849
227 Ga0316584_0035469
228 Ga0395900_0149162
229 Ga0395898_0666269
230 Ga0436364_0115620
231 Ga0436364_0815200
232 Ga0242420_005833
233 Ga0436361_0832836
234 Ga0436362_0198274
235 Ga0439466_0044633
236 Ga0451793_0055941
237 Ga0451807_0574335
238 Ga0439449_0032466
239 Ga0451577_0321307
240 Ga0466957_0035214
241 Ga0451576_0165265
242 Ga0495590_0012345
243 Ga0495594_0197891
244 Ga0495594_0518301
245 Ga0495667_0070071
246 Ga0495656_0015015
247 Ga0495635_0406507
248 Ga0495636_0008323
249 Ga0495636_0057577
250 Ga0495687_000135
251 Ga0496102_0448456
252 Ga0496104_0108796
253 Ga0496106_0186970
254 Ga0496109_0002317
255 Ga0496110_0026198
256 Ga0496112_0307482
257 Ga0496113_0144038
258 Ga0496113_0413641
259 Ga0496126_0054285
260 Ga0501290_035004
261 Ga0501034_0056104
262 Ga0501036_0630486
263 Ga0501040_0150751
264 Ga0501040_0404037
265 Ga0501041_0308022
266 Ga0501046_0456186
267 Ga0501047_0037627
268 Ga0501047_0190531
269 Ga0501048_0185197
270 Ga0501073_0107580
271 Ga0501073_0525082
272 Ga0501074_0199260
273 Ga0501074_0283316
274 Ga0501075_0218991
275 Ga0501076_0435496
276 Ga0501077_0281045
277 Ga0501079_0186019
278 Ga0501079_0248788
279 Ga0501275_000951
280 Ga0501035_1028035
281 Ga0501044_0003566
282 Ga0501045_0123898
283 Ga0501045_0257167
284 Ga0501045_0645514
285 Ga0495595_0221441
286 Ga0495619_0228700
287 Ga0500578_0031296
288 Ga0500644_0064303
289 Ga0500642_0128053
290 Ga0500559_0224557
291 Ga0500561_0039282
292 Ga0500616_0022448
293 Ga0500633_0001116
294 Ga0500636_0239185
295 Ga0500637_0408376
296 Ga0501084_0133267
297 Ga0590075_048956
298 Ga0590077_051160
299 Ga0501082_0118344
300 Ga0501082_0174980
301 Ga0530510_0144096
302 2739646019
303 2842088138
304 2919512435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

18

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.8869 4 170
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.8775 4 170
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.877 4 170
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.8593 5 168
1p7m-assembly1.cif.gz_A solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i 0.8185 3 167
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8805 5 174 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8784 9 170 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8776 4 170 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8464 3 169 1.10.340.30
af_A0A1D6I4F4_25_202_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8377 12 168 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7T8MNA3-F1-model_v4 deleted 1 1 192
AF-A0A0S2F813-F1-model_v4 Methyladenine glycosylase family protein 1 1 189 GO:0006284
GO:0008725
GO:0046872
AF-A0A4R5UBI4-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9961 1 175 GO:0006284
GO:0008725
GO:0046872
AF-A0A7Y4VWP0-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9939 1 180 GO:0006284
GO:0008725
GO:0046872
AF-A0A7S6UF13-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9938 2 180 GO:0006284
GO:0008725
GO:0046872

Map