F215054

General Info

Members Datasets Scaffolds Average Seq Length
152 38 152 106

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0428548|Ga0451577_0428548_13_408
Length 131
Sequence LKEFNLKSTKFVAHFQNRRKNIKNTIMALEVNDANFEEVVLQSEVPVLVDFWAEWCGPCRMVGPIVEELAEEYKGRVVVAKMDVDSNPGIPSKLGIRNIPTVLFFKGGEQVDKQVGAVPKTVFAQKIEALL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
3 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
4 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
5 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
6 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
7 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
8 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
9 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
10 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
11 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
12 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
13 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
14 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
15 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
16 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
17 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
18 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
19 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
20 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
21 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
22 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
25 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
26 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
27 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
28 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
29 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
30 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
31 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
32 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
33 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
34 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
35 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
36 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
37 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
38 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.97
Rhizosphere 92.76
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_102171374 3300005329 Unclassified 533
2 Ga0068856_100224641 3300005614 Bacteria 1893
3 Ga0068856_102075866 3300005614 Bacteria 578
4 Ga0157371_10055864 3300013102 Bacteria 2801
5 Ga0157378_10017608 3300013297 Bacteria 6273
6 Ga0157372_10050287 3300013307 Bacteria 4637
7 Ga0157372_10615083 3300013307 Bacteria 1266
8 Ga0207702_11239983 3300026078 Bacteria 740
9 Ga0207702_12427531 3300026078 Bacteria 511
10 Ga0265337_1098989 3300028556 Bacteria 794
11 Ga0265337_1132948 3300028556 Bacteria 674
12 Ga0265323_10089333 3300028653 Bacteria 1032
13 Ga0265323_10119645 3300028653 Unclassified 859
14 Ga0265322_10073309 3300028654 Bacteria 971
15 Ga0265336_10013035 3300028666 Unclassified 2781
16 Ga0265338_10064858 3300028800 Unclassified 3173
17 Ga0265330_10097206 3300031235 Bacteria 1262
18 Ga0265327_10002931 3300031251 Bacteria 17082
19 Ga0265327_10017144 3300031251 Bacteria 4559
20 Ga0265327_10087880 3300031251 Bacteria 1522
21 Ga0265327_10295694 3300031251 Bacteria 714
22 Ga0265327_10330137 3300031251 Bacteria 668
23 Ga0265316_10000849 3300031344 Bacteria 33666
24 Ga0265316_10001380 3300031344 Bacteria 26164
25 Ga0265316_10281731 3300031344 Unclassified 1214
26 Ga0265316_11059515 3300031344 Bacteria 563
27 Ga0265316_11131128 3300031344 Bacteria 543
28 Ga0316575_10379773 3300031665 Bacteria 604
29 Ga0265342_10028201 3300031712 Bacteria 3501
30 Ga0265342_10039528 3300031712 Bacteria 2866
31 Ga0265342_10128213 3300031712 Bacteria 1424
32 Ga0265342_10396609 3300031712 Unclassified 713
33 Ga0316576_10061641 3300031727 Bacteria 2749
34 Ga0316576_10805177 3300031727 Bacteria 676
35 Ga0316578_10014760 3300031728 Unclassified 4184
36 Ga0316578_10045566 3300031728 Bacteria 2553
37 Ga0316577_10047532 3300031733 Unclassified 2396
38 Ga0316577_10549050 3300031733 Unclassified 657
39 Ga0316585_10048638 3300032137 Unclassified 1359
40 Ga0316585_10220011 3300032137 Bacteria 628
41 Ga0316580_10059844 3300032139 Bacteria 1170
42 Ga0316593_10036651 3300032168 Unclassified 1618
43 Ga0316592_1092433 3300033524 Bacteria 693
44 Ga0316574_0019066 3300035398 Bacteria 4044
45 Ga0316582_0134085 3300036647 Bacteria 1666
46 Ga0316582_0422181 3300036647 Bacteria 919
47 Ga0316582_0513914 3300036647 Bacteria 825
48 Ga0316584_0016986 3300036712 Bacteria 5223
49 Ga0316584_0344532 3300036712 Bacteria 1071
50 Ga0316584_0563878 3300036712 Unclassified 793
51 Ga0395905_0000003 3300037471 Bacteria 1347396
52 Ga0400490_45660 3300038726 Bacteria 57177
53 Ga0400490_56197 3300038726 Bacteria 1281
54 Ga0400483_006364 3300039062 Bacteria 1003
55 Ga0400483_058674 3300039062 Bacteria 1019
56 Ga0400483_217240 3300039062 Bacteria 56079
57 Ga0400489_23710 3300039093 Bacteria 1048
58 Ga0400489_54613 3300039093 Bacteria 1641
59 Ga0451795_0401854 3300041456 Bacteria 580
60 Ga0451795_1642815 3300041456 Bacteria 627
61 Ga0451807_0478732 3300041486 Bacteria 1332
62 Ga0451855_0105921 3300041511 Unclassified 567
63 Ga0451577_0000037 3300042876 Bacteria 360162
64 Ga0451577_0000938 3300042876 Bacteria 42880
65 Ga0451577_0013171 3300042876 Bacteria 7749
66 Ga0451577_0018510 3300042876 Bacteria 6416
67 Ga0451577_0043167 3300042876 Bacteria 4039
68 Ga0451577_0088786 3300042876 Bacteria 2758
69 Ga0451577_0107440 3300042876 Bacteria 2494
70 Ga0451577_0151360 3300042876 Bacteria 2088
71 Ga0451577_0172917 3300042876 Bacteria 1946
72 Ga0451577_0172950 3300042876 Bacteria 1946
73 Ga0451577_0183045 3300042876 Bacteria 1889
74 Ga0451577_0211983 3300042876 Bacteria 1750
75 Ga0451577_0216324 3300042876 Bacteria 1731
76 Ga0451577_0265179 3300042876 Bacteria 1555
77 Ga0451577_0361639 3300042876 Bacteria 1316
78 Ga0451577_0428548 3300042876 Bacteria 1201
79 Ga0451577_0429681 3300042876 Bacteria 1199
80 Ga0451577_0598817 3300042876 Bacteria 1000
81 Ga0451577_0783956 3300042876 Bacteria 861
82 Ga0451577_1174321 3300042876 Bacteria 685
83 Ga0451577_1742840 3300042876 Bacteria 547
84 Ga0453683_0000042 3300044673 Bacteria 217883
85 Ga0453683_0000085 3300044673 Bacteria 140003
86 Ga0453683_0000166 3300044673 Bacteria 94433
87 Ga0453683_0019738 3300044673 Bacteria 4313
88 Ga0453683_0022076 3300044673 Bacteria 4060
89 Ga0453683_0032148 3300044673 Bacteria 3312
90 Ga0453683_0072322 3300044673 Unclassified 2158
91 Ga0453683_0338554 3300044673 Bacteria 965
92 Ga0453683_0358975 3300044673 Bacteria 936
93 Ga0453683_0694671 3300044673 Bacteria 666
94 Ga0453683_0813780 3300044673 Bacteria 615
95 Ga0453684_0000110 3300044712 Bacteria 360542
96 Ga0453684_0000225 3300044712 Bacteria 245902
97 Ga0453684_0000570 3300044712 Bacteria 137760
98 Ga0453684_0001188 3300044712 Bacteria 80449
99 Ga0453684_0002152 3300044712 Bacteria 49337
100 Ga0453684_0004957 3300044712 Bacteria 27111
101 Ga0453684_0005504 3300044712 Bacteria 25013
102 Ga0453684_0013432 3300044712 Bacteria 13296
103 Ga0453684_0021029 3300044712 Bacteria 9784
104 Ga0453684_0021328 3300044712 Bacteria 9688
105 Ga0453684_0038996 3300044712 Bacteria 6481
106 Ga0453684_0046915 3300044712 Bacteria 5738
107 Ga0453684_0054430 3300044712 Bacteria 5212
108 Ga0453684_0063385 3300044712 Bacteria 4728
109 Ga0453684_0077597 3300044712 Bacteria 4161
110 Ga0453684_0147145 3300044712 Bacteria 2804
111 Ga0453684_0168725 3300044712 Bacteria 2581
112 Ga0453684_0184736 3300044712 Bacteria 2444
113 Ga0453684_0187469 3300044712 Bacteria 2422
114 Ga0453684_0202272 3300044712 Bacteria 2315
115 Ga0453684_0228088 3300044712 Bacteria 2152
116 Ga0453684_0502729 3300044712 Bacteria 1342
117 Ga0453684_0535368 3300044712 Unclassified 1292
118 Ga0453684_0590693 3300044712 Bacteria 1218
119 Ga0453684_0630377 3300044712 Bacteria 1172
120 Ga0453684_0646622 3300044712 Bacteria 1154
121 Ga0453684_1235885 3300044712 Bacteria 782
122 Ga0453684_1283859 3300044712 Bacteria 764
123 Ga0453684_1284488 3300044712 Bacteria 764
124 Ga0453684_1755542 3300044712 Unclassified 632
125 Ga0453684_2256457 3300044712 Bacteria 542
126 Ga0453684_2311304 3300044712 Bacteria 534
127 Ga0453684_2376688 3300044712 Bacteria 525
128 Ga0453684_2509424 3300044712 Bacteria 508
129 Ga0451576_0000039 3300045051 Bacteria 360162
130 Ga0451576_0000095 3300045051 Bacteria 223485
131 Ga0451576_0001135 3300045051 Bacteria 48115
132 Ga0451576_0001272 3300045051 Bacteria 44236
133 Ga0451576_0004474 3300045051 Bacteria 18100
134 Ga0451576_0030336 3300045051 Bacteria 5779
135 Ga0451576_0038428 3300045051 Bacteria 5065
136 Ga0451576_0065996 3300045051 Bacteria 3768
137 Ga0451576_0137213 3300045051 Bacteria 2551
138 Ga0451576_0161101 3300045051 Bacteria 2341
139 Ga0451576_0178883 3300045051 Bacteria 2214
140 Ga0451576_0191323 3300045051 Bacteria 2137
141 Ga0451576_0303963 3300045051 Unclassified 1669
142 Ga0451576_0317761 3300045051 Bacteria 1629
143 Ga0451576_0374952 3300045051 Bacteria 1491
144 Ga0451576_0426999 3300045051 Bacteria 1391
145 Ga0451576_0772186 3300045051 Bacteria 1009
146 Ga0451576_0855940 3300045051 Bacteria 954
147 Ga0451576_0888073 3300045051 Bacteria 935
148 Ga0451576_0949251 3300045051 Bacteria 902
149 Ga0451576_0968745 3300045051 Bacteria 892
150 Ga0451576_1123956 3300045051 Bacteria 822
151 Ga0451576_1680971 3300045051 Bacteria 658
152 Ga0501034_0036076 3300049571 Bacteria 5013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_0401854 Ga0451795_0401854_55_372 104
2 3300041456 Ga0451795_1642815 Ga0451795_1642815_112_498 104
3 3300044712 Ga0453684_1283859 Ga0453684_1283859_382_696 104
4 3300045051 Ga0451576_0949251 Ga0451576_0949251_133_447 104
5 3300005614 Ga0068856_100224641 Ga0068856_1002246412 105
6 3300005614 Ga0068856_102075866 Ga0068856_1020758661 105
7 3300013102 Ga0157371_10055864 Ga0157371_100558643 105
8 3300013297 Ga0157378_10017608 Ga0157378_100176082 105
9 3300013307 Ga0157372_10050287 Ga0157372_100502872 105
10 3300013307 Ga0157372_10615083 Ga0157372_106150832 105
11 3300026078 Ga0207702_11239983 Ga0207702_112399832 105
12 3300026078 Ga0207702_12427531 Ga0207702_124275311 105
13 3300028556 Ga0265337_1098989 Ga0265337_10989891 105
14 3300028556 Ga0265337_1132948 Ga0265337_11329481 105
15 3300028653 Ga0265323_10089333 Ga0265323_100893332 105
16 3300028653 Ga0265323_10119645 Ga0265323_101196452 105
17 3300028654 Ga0265322_10073309 Ga0265322_100733092 105
18 3300028666 Ga0265336_10013035 Ga0265336_100130353 105
19 3300028800 Ga0265338_10064858 Ga0265338_100648582 105
20 3300031235 Ga0265330_10097206 Ga0265330_100972062 105
21 3300031251 Ga0265327_10002931 Ga0265327_1000293110 105
22 3300031251 Ga0265327_10017144 Ga0265327_100171442 105
23 3300031251 Ga0265327_10087880 Ga0265327_100878802 105
24 3300031251 Ga0265327_10295694 Ga0265327_102956941 105
25 3300031251 Ga0265327_10330137 Ga0265327_103301372 105
26 3300031344 Ga0265316_10000849 Ga0265316_1000084925 105
27 3300031344 Ga0265316_10001380 Ga0265316_100013804 105
28 3300031344 Ga0265316_10281731 Ga0265316_102817313 105
29 3300031344 Ga0265316_11059515 Ga0265316_110595151 105
30 3300031344 Ga0265316_11131128 Ga0265316_111311282 105
31 3300031665 Ga0316575_10379773 Ga0316575_103797732 105
32 3300031712 Ga0265342_10028201 Ga0265342_100282012 105
33 3300031712 Ga0265342_10039528 Ga0265342_100395282 105
34 3300031712 Ga0265342_10128213 Ga0265342_101282132 105
35 3300031712 Ga0265342_10396609 Ga0265342_103966091 105
36 3300031727 Ga0316576_10061641 Ga0316576_100616412 105
37 3300031727 Ga0316576_10805177 Ga0316576_108051771 105
38 3300031728 Ga0316578_10014760 Ga0316578_100147602 105
39 3300031728 Ga0316578_10045566 Ga0316578_100455662 105
40 3300031733 Ga0316577_10047532 Ga0316577_100475322 105
41 3300031733 Ga0316577_10549050 Ga0316577_105490502 105
42 3300032137 Ga0316585_10048638 Ga0316585_100486382 105
43 3300032137 Ga0316585_10220011 Ga0316585_102200111 105
44 3300032139 Ga0316580_10059844 Ga0316580_100598443 105
45 3300033524 Ga0316592_1092433 Ga0316592_10924331 105
46 3300035398 Ga0316574_0019066 Ga0316574_0019066_303_620 105
47 3300036647 Ga0316582_0134085 Ga0316582_0134085_322_639 105
48 3300036647 Ga0316582_0422181 Ga0316582_0422181_132_449 105
49 3300036647 Ga0316582_0513914 Ga0316582_0513914_489_812 105
50 3300036712 Ga0316584_0016986 Ga0316584_0016986_4252_4569 105
51 3300036712 Ga0316584_0344532 Ga0316584_0344532_362_679 105
52 3300036712 Ga0316584_0563878 Ga0316584_0563878_412_729 105
53 3300037471 Ga0395905_0000003 Ga0395905_0000003_485953_486270 105
54 3300038726 Ga0400490_45660 Ga0400490_45660_29785_30102 105
55 3300038726 Ga0400490_56197 Ga0400490_56197_942_1259 105
56 3300039062 Ga0400483_006364 Ga0400483_006364_233_550 105
57 3300039062 Ga0400483_058674 Ga0400483_058674_623_940 105
58 3300039062 Ga0400483_217240 Ga0400483_217240_13025_13342 105
59 3300039093 Ga0400489_23710 Ga0400489_23710_568_885 105
60 3300039093 Ga0400489_54613 Ga0400489_54613_941_1258 105
61 3300041486 Ga0451807_0478732 Ga0451807_0478732_80_397 105
62 3300041511 Ga0451855_0105921 Ga0451855_0105921_53_370 105
63 3300042876 Ga0451577_0000037 Ga0451577_0000037_248073_248390 105
64 3300042876 Ga0451577_0000938 Ga0451577_0000938_26345_26662 105
65 3300042876 Ga0451577_0013171 Ga0451577_0013171_7236_7553 105
66 3300042876 Ga0451577_0018510 Ga0451577_0018510_1339_1656 105
67 3300042876 Ga0451577_0043167 Ga0451577_0043167_2273_2590 105
68 3300042876 Ga0451577_0088786 Ga0451577_0088786_60_377 105
69 3300042876 Ga0451577_0107440 Ga0451577_0107440_835_1152 105
70 3300042876 Ga0451577_0151360 Ga0451577_0151360_1722_2039 105
71 3300042876 Ga0451577_0172917 Ga0451577_0172917_91_408 105
72 3300042876 Ga0451577_0172950 Ga0451577_0172950_376_693 105
73 3300042876 Ga0451577_0183045 Ga0451577_0183045_457_774 105
74 3300042876 Ga0451577_0211983 Ga0451577_0211983_118_435 105
75 3300042876 Ga0451577_0216324 Ga0451577_0216324_175_492 105
76 3300042876 Ga0451577_0265179 Ga0451577_0265179_786_1103 105
77 3300042876 Ga0451577_0361639 Ga0451577_0361639_328_645 105
78 3300042876 Ga0451577_0428548 Ga0451577_0428548_13_408 105
79 3300042876 Ga0451577_0429681 Ga0451577_0429681_335_652 105
80 3300042876 Ga0451577_0598817 Ga0451577_0598817_287_604 105
81 3300042876 Ga0451577_0783956 Ga0451577_0783956_512_829 105
82 3300042876 Ga0451577_1174321 Ga0451577_1174321_153_470 105
83 3300042876 Ga0451577_1742840 Ga0451577_1742840_108_425 105
84 3300044673 Ga0453683_0000042 Ga0453683_0000042_77799_78116 105
85 3300044673 Ga0453683_0000085 Ga0453683_0000085_26297_26614 105
86 3300044673 Ga0453683_0000166 Ga0453683_0000166_69691_70008 105
87 3300044673 Ga0453683_0019738 Ga0453683_0019738_1405_1722 105
88 3300044673 Ga0453683_0022076 Ga0453683_0022076_3054_3371 105
89 3300044673 Ga0453683_0032148 Ga0453683_0032148_2335_2652 105
90 3300044673 Ga0453683_0072322 Ga0453683_0072322_77_394 105
91 3300044673 Ga0453683_0338554 Ga0453683_0338554_624_941 105
92 3300044673 Ga0453683_0358975 Ga0453683_0358975_69_386 105
93 3300044673 Ga0453683_0694671 Ga0453683_0694671_281_598 105
94 3300044673 Ga0453683_0813780 Ga0453683_0813780_102_419 105
95 3300044712 Ga0453684_0000110 Ga0453684_0000110_248453_248770 105
96 3300044712 Ga0453684_0000225 Ga0453684_0000225_52671_52988 105
97 3300044712 Ga0453684_0000570 Ga0453684_0000570_103851_104168 105
98 3300044712 Ga0453684_0001188 Ga0453684_0001188_42654_42971 105
99 3300044712 Ga0453684_0002152 Ga0453684_0002152_48472_48867 105
100 3300044712 Ga0453684_0004957 Ga0453684_0004957_10697_11014 105
101 3300044712 Ga0453684_0005504 Ga0453684_0005504_19870_20187 105
102 3300044712 Ga0453684_0013432 Ga0453684_0013432_10788_11105 105
103 3300044712 Ga0453684_0021029 Ga0453684_0021029_2926_3243 105
104 3300044712 Ga0453684_0038996 Ga0453684_0038996_4209_4526 105
105 3300044712 Ga0453684_0046915 Ga0453684_0046915_4211_4528 105
106 3300044712 Ga0453684_0054430 Ga0453684_0054430_215_532 105
107 3300044712 Ga0453684_0063385 Ga0453684_0063385_4323_4640 105
108 3300044712 Ga0453684_0077597 Ga0453684_0077597_2315_2632 105
109 3300044712 Ga0453684_0147145 Ga0453684_0147145_1637_1954 105
110 3300044712 Ga0453684_0168725 Ga0453684_0168725_2176_2493 105
111 3300044712 Ga0453684_0184736 Ga0453684_0184736_198_515 105
112 3300044712 Ga0453684_0187469 Ga0453684_0187469_650_967 105
113 3300044712 Ga0453684_0202272 Ga0453684_0202272_1219_1536 105
114 3300044712 Ga0453684_0228088 Ga0453684_0228088_719_1036 105
115 3300044712 Ga0453684_0502729 Ga0453684_0502729_44_361 105
116 3300044712 Ga0453684_0535368 Ga0453684_0535368_95_412 105
117 3300044712 Ga0453684_0590693 Ga0453684_0590693_246_563 105
118 3300044712 Ga0453684_0630377 Ga0453684_0630377_642_959 105
119 3300044712 Ga0453684_0646622 Ga0453684_0646622_351_668 105
120 3300044712 Ga0453684_1235885 Ga0453684_1235885_414_731 105
121 3300044712 Ga0453684_1284488 Ga0453684_1284488_73_390 105
122 3300044712 Ga0453684_1755542 Ga0453684_1755542_261_578 105
123 3300044712 Ga0453684_2256457 Ga0453684_2256457_142_459 105
124 3300044712 Ga0453684_2376688 Ga0453684_2376688_57_374 105
125 3300044712 Ga0453684_2509424 Ga0453684_2509424_148_465 105
126 3300045051 Ga0451576_0000039 Ga0451576_0000039_111773_112090 105
127 3300045051 Ga0451576_0000095 Ga0451576_0000095_119320_119637 105
128 3300045051 Ga0451576_0001135 Ga0451576_0001135_11723_12040 105
129 3300045051 Ga0451576_0001272 Ga0451576_0001272_27713_28030 105
130 3300045051 Ga0451576_0004474 Ga0451576_0004474_8570_8887 105
131 3300045051 Ga0451576_0038428 Ga0451576_0038428_425_742 105
132 3300045051 Ga0451576_0065996 Ga0451576_0065996_1262_1579 105
133 3300045051 Ga0451576_0137213 Ga0451576_0137213_968_1285 105
134 3300045051 Ga0451576_0161101 Ga0451576_0161101_1134_1451 105
135 3300045051 Ga0451576_0178883 Ga0451576_0178883_878_1195 105
136 3300045051 Ga0451576_0191323 Ga0451576_0191323_573_890 105
137 3300045051 Ga0451576_0303963 Ga0451576_0303963_94_411 105
138 3300045051 Ga0451576_0317761 Ga0451576_0317761_1277_1594 105
139 3300045051 Ga0451576_0374952 Ga0451576_0374952_999_1316 105
140 3300045051 Ga0451576_0426999 Ga0451576_0426999_547_864 105
141 3300045051 Ga0451576_0772186 Ga0451576_0772186_371_688 105
142 3300045051 Ga0451576_0855940 Ga0451576_0855940_219_536 105
143 3300045051 Ga0451576_0888073 Ga0451576_0888073_478_795 105
144 3300045051 Ga0451576_0968745 Ga0451576_0968745_78_395 105
145 3300045051 Ga0451576_1123956 Ga0451576_1123956_47_364 105
146 3300045051 Ga0451576_1680971 Ga0451576_1680971_20_337 105
147 3300005329 Ga0070683_102171374 Ga0070683_1021713741 106
148 3300032168 Ga0316593_10036651 Ga0316593_100366511 106
149 3300044712 Ga0453684_0021328 Ga0453684_0021328_9245_9565 106
150 3300044712 Ga0453684_2311304 Ga0453684_2311304_163_483 106
151 3300045051 Ga0451576_0030336 Ga0451576_0030336_1841_2161 106
152 3300049571 Ga0501034_0036076 Ga0501034_0036076_2085_2405 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

27

129

0.97

PF13098

Thioredoxin_2

Thioredoxin-like domain

40

127

0.89

PF14595

Thioredoxin_9

Thioredoxin

5

129

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fb6-assembly1.cif.gz_A crystal structure of thioredoxin m from spinach chloroplast (oxidized form) 0.9918 2 105
2puk-assembly2.cif.gz_G crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m 0.9859 1 105
4ba7-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last bacteria common ancestor (lbca) from the precambrian period 0.9851 1 105
1fb6-assembly1.cif.gz_A crystal structure of thioredoxin m from spinach chloroplast (oxidized form) 0.9825 2 105
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9815 2 102
ID Description Score Start End Superfamily
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9816 2 105 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9795 30 105 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9772 1 105 3.40.30.10
3tcoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9745 2 105 3.40.30.10
2e0qA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9682 2 103 3.40.30.10
ID Description Score Start End GO Terms
AF-H8KXY0-F1-model_v4 Thioredoxin 1.004 1 106 GO:0005829
GO:0015035
GO:0045454
AF-A0A2P8CKV5-F1-model_v4 Thioredoxin 1.004 1 105 GO:0005829
GO:0015035
GO:0045454
AF-A0A7C3KVH9-F1-model_v4 Thioredoxin 1.003 1 105 GO:0005737
GO:0015035
AF-A0A401XNP7-F1-model_v4 Thioredoxin 1.002 1 105 GO:0005829
GO:0015035
GO:0045454
AF-A0A1F3KVA8-F1-model_v4 Thioredoxin 1.002 3 104 GO:0005829
GO:0015035
GO:0045454

Feature Viewer

pLDDT pTM Quality
96.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map