F214964

General Info

Members Datasets Scaffolds Average Seq Length
152 106 304 216

Family's Representative Sequence

Representative Sequence 3300039093|Ga0400489_55210|Ga0400489_55210_1582_2295
Length 237
Sequence MTRVKICGITNIEDARVAVEAGADFLGFIFYPQSPRYVTPDQVREIVSLLVRPMAHDKVPTSLLPTPYFTGVFVNQETETVAQTLEFCGLDYAQLHGAASPQAVRALVERGYGVIKAFRVRDGGDLSELERYPATAYLLDTYVAGLMGGTGRSFDWKLAAQAAQYGPIMLAGGLTPDNVAQAIQTARPWAVDVSSGTESAPGRKDHDKVRCFVQAAQAITQAPAGLSNPAASNQIYG

Samples

Sample ID Description Type Environment
1 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
104 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400489_55210 3300039093 Bacteria 4283
2 rootH1_10019710 3300003316 Bacteria 2518
3 Ga0070658_10001360 3300005327 Bacteria 20911
4 Ga0070670_100000198 3300005331 Bacteria 55773
5 Ga0070689_100053220 3300005340 Bacteria 3132
6 Ga0070692_10148723 3300005345 Bacteria 1332
7 Ga0070673_100754408 3300005364 Bacteria 896
8 Ga0070700_100000016 3300005441 Bacteria 147213
9 Ga0070694_100460148 3300005444 Unclassified 1006
10 Ga0070708_100001189 3300005445 Bacteria 20006
11 Ga0070681_10916537 3300005458 Unclassified 795
12 Ga0070706_100015670 3300005467 Bacteria 7002
13 Ga0070707_100003816 3300005468 Bacteria 14205
14 Ga0070698_100190535 3300005471 Bacteria 1988
15 Ga0070699_100036172 3300005518 Bacteria 4271
16 Ga0070704_100076050 3300005549 Bacteria 2455
17 Ga0068864_100011062 3300005618 Bacteria 7458
18 Ga0068864_101071011 3300005618 Unclassified 801
19 Ga0068860_100494539 3300005843 Bacteria 1220
20 Ga0081539_10000035 3300005985 Bacteria 302689
21 Ga0097621_100545783 3300006237 Bacteria 1055
22 Ga0075428_100013931 3300006844 Bacteria 8954
23 Ga0075428_100017153 3300006844 Bacteria 7999
24 Ga0075428_100307487 3300006844 Unclassified 1704
25 Ga0075431_100001066 3300006847 Bacteria 24557
26 Ga0075431_100013594 3300006847 Bacteria 8225
27 Ga0075433_10007093 3300006852 Bacteria 8873
28 Ga0075433_10139518 3300006852 Bacteria 2155
29 Ga0075434_100036273 3300006871 Bacteria 4878
30 Ga0075429_100183622 3300006880 Bacteria 1833
31 Ga0075429_100449626 3300006880 Unclassified 1129
32 Ga0075436_100071669 3300006914 Bacteria 2396
33 Ga0075435_100119953 3300007076 Bacteria 2194
34 Ga0075435_100713996 3300007076 Bacteria 871
35 Ga0105240_10014143 3300009093 Bacteria 10902
36 Ga0111539_10016997 3300009094 Bacteria 9003
37 Ga0111539_11094786 3300009094 Unclassified 926
38 Ga0114129_10000429 3300009147 Bacteria 49946
39 Ga0114129_10000549 3300009147 Bacteria 45986
40 Ga0114129_10002456 3300009147 Bacteria 25728
41 Ga0114129_10202595 3300009147 Bacteria 2687
42 Ga0114129_10393936 3300009147 Bacteria 1826
43 Ga0114129_11035005 3300009147 Bacteria 1032
44 Ga0105243_10585990 3300009148 Unclassified 1071
45 Ga0105242_10399088 3300009176 Bacteria 1283
46 Ga0105237_10000216 3300009545 Bacteria 80971
47 Ga0105238_10000018 3300009551 Bacteria 223340
48 Ga0105239_10043457 3300010375 Bacteria 4926
49 Ga0157373_10037808 3300013100 Bacteria 3459
50 Ga0157374_10000005 3300013296 Bacteria 646767
51 Ga0157374_10363292 3300013296 Bacteria 1440
52 Ga0157378_10053038 3300013297 Bacteria 3610
53 Ga0157378_10257886 3300013297 Bacteria 1672
54 Ga0157375_11275376 3300013308 Bacteria 863
55 Ga0157380_10152077 3300014326 Bacteria 2002
56 Ga0157380_10917498 3300014326 Unclassified 903
57 Ga0157377_10000001 3300014745 Bacteria 623098
58 Ga0213876_10000475 3300021384 Bacteria 31994
59 Ga0207684_10000177 3300025910 Bacteria 104811
60 Ga0207695_10045507 3300025913 Bacteria 4657
61 Ga0207671_10000247 3300025914 Bacteria 80952
62 Ga0207694_10000001 3300025924 Bacteria 4078485
63 Ga0207709_10515323 3300025935 Unclassified 935
64 Ga0207670_10028702 3300025936 Bacteria 3537
65 Ga0207651_10644035 3300025960 Bacteria 930
66 Ga0207640_10065838 3300025981 Bacteria 2419
67 Ga0207708_10000005 3300026075 Bacteria 284735
68 Ga0207648_10079120 3300026089 Unclassified 2868
69 Ga0207428_10015071 3300027907 Bacteria 6696
70 Ga0207428_10085652 3300027907 Bacteria 2453
71 Ga0268264_10036141 3300028381 Bacteria 4067
72 Ga0265323_10017362 3300028653 Bacteria 2795
73 Ga0265330_10061935 3300031235 Bacteria 1627
74 Ga0265332_10189054 3300031238 Unclassified 857
75 Ga0265329_10037496 3300031242 Bacteria 1561
76 Ga0265331_10059829 3300031250 Bacteria 1801
77 Ga0265316_10009912 3300031344 Bacteria 8729
78 Ga0265316_10032702 3300031344 Bacteria 4243
79 Ga0265316_10035640 3300031344 Bacteria 4030
80 Ga0265316_10337944 3300031344 Unclassified 1092
81 Ga0265314_10163905 3300031711 Bacteria 1349
82 Ga0307405_10083023 3300031731 Bacteria 2099
83 Ga0307406_10064477 3300031901 Bacteria 2378
84 Ga0307406_10108521 3300031901 Bacteria 1906
85 Ga0307407_10183159 3300031903 Bacteria 1390
86 Ga0307412_10215249 3300031911 Bacteria 1469
87 Ga0307409_100007881 3300031995 Bacteria 6413
88 Ga0307409_100033209 3300031995 Bacteria 3752
89 Ga0307409_100057177 3300031995 Bacteria 3021
90 Ga0395900_0065251 3300037418 Bacteria 3740
91 Ga0395898_0492337 3300037466 Bacteria 1166
92 Ga0395905_0402811 3300037471 Bacteria 1263
93 Ga0436364_0844863 3300037853 Bacteria 12763
94 Ga0400483_015735 3300039062 Bacteria 1499
95 Ga0400483_184174 3300039062 Bacteria 1447
96 Ga0400489_27327 3300039093 Bacteria 41514
97 Ga0436365_0039241 3300039437 Bacteria 90885
98 Ga0451577_0214426 3300042876 Bacteria 1740
99 Ga0453683_0065738 3300044673 Bacteria 2267
100 Ga0453683_0070562 3300044673 Bacteria 2185
101 Ga0453684_0468175 3300044712 Bacteria 1400
102 Ga0451576_0018791 3300045051 Bacteria 7557
103 Ga0501036_0168568 3300049572 Bacteria 1845
104 Ga0501038_0087402 3300049574 Bacteria 2618
105 Ga0501041_0047314 3300049577 Bacteria 2618
106 Ga0501042_0135269 3300049578 Bacteria 1777
107 Ga0501046_0082066 3300049580 Bacteria 2490
108 Ga0501048_0054017 3300049582 Bacteria 2854
109 Ga0501068_0111667 3300049584 Bacteria 1700
110 Ga0501072_0010506 3300049588 Bacteria 7049
111 Ga0501072_0084314 3300049588 Bacteria 2519
112 Ga0501072_0241286 3300049588 Bacteria 1439
113 Ga0501073_0265291 3300049589 Bacteria 1185
114 Ga0501075_0025690 3300049591 Bacteria 4327
115 Ga0501076_0007617 3300049592 Bacteria 7884
116 Ga0501077_0002006 3300049593 Bacteria 12292
117 Ga0501077_0176825 3300049593 Bacteria 1356
118 Ga0501079_0059699 3300049741 Bacteria 2941
119 Ga0501080_0121936 3300049742 Bacteria 2415
120 Ga0501081_0003553 3300049743 Bacteria 9958
121 Ga0501081_0072947 3300049743 Bacteria 2394
122 Ga0501045_0030772 3300049824 Bacteria 3885
123 Ga0501045_0202011 3300049824 Bacteria 1481
124 nmdc:mga05p37_14634_c1 3300050507 Bacteria 9424
125 nmdc:mga05p37_17270_c1 3300050507 Bacteria 8704
126 nmdc:mga05p37_2347_c1 3300050507 Bacteria 22024
127 nmdc:mga05p37_2727_c1 3300050507 Bacteria 20518
128 nmdc:mga05p37_334807_c1 3300050507 Bacteria 1787
129 nmdc:mga05p37_5073_c1 3300050507 Bacteria 15436
130 nmdc:mga09592_250762_c1 3300050508 Bacteria 1534
131 nmdc:mga09592_373290_c1 3300050508 Bacteria 1234
132 nmdc:mga09592_399076_c1 3300050508 Bacteria 1189
133 nmdc:mga09592_40245_c1 3300050508 Bacteria 2991
134 nmdc:mga0qj67_488353_c1 3300050509 Bacteria 990
135 nmdc:mga06r32_344879_c1 3300050510 Bacteria 1474
136 nmdc:mga06r32_6598_c1 3300050510 Bacteria 10426
137 nmdc:mga08y16_10225_c1 3300050511 Bacteria 9848
138 nmdc:mga0n895_246_c1 3300050512 Bacteria 34623
139 nmdc:mga0n895_46771_c1 3300050512 Bacteria 4229
140 nmdc:mga0rr50_180476_c1 3300050513 Bacteria 1725
141 nmdc:mga0rr50_374755_c1 3300050513 Bacteria 1199
142 nmdc:mga08x19_902_c1 3300050514 Bacteria 18833
143 nmdc:mga0a205_5929_c1 3300050515 Bacteria 11013
144 nmdc:mga0a205_60313_c1 3300050515 Bacteria 3664
145 nmdc:mga0a205_653_c1 3300050515 Bacteria 27584
146 Ga0501084_0032577 3300054114 Bacteria 4359
147 Ga0501084_0250559 3300054114 Bacteria 1495
148 Ga0590074_011317 3300059423 Bacteria 1496
149 Ga0590075_028152 3300059424 Bacteria 1419
150 Ga0501082_0035214 3300060353 Bacteria 4315
151 Ga0501082_0175583 3300060353 Unclassified 1863
152 Ga0530510_0017678 3300061734 Bacteria 5053
153 Ga0400489_55210
154 rootH1_10019710
155 Ga0070658_10001360
156 Ga0070670_100000198
157 Ga0070689_100053220
158 Ga0070692_10148723
159 Ga0070673_100754408
160 Ga0070700_100000016
161 Ga0070694_100460148
162 Ga0070708_100001189
163 Ga0070681_10916537
164 Ga0070706_100015670
165 Ga0070707_100003816
166 Ga0070698_100190535
167 Ga0070699_100036172
168 Ga0070704_100076050
169 Ga0068864_100011062
170 Ga0068864_101071011
171 Ga0068860_100494539
172 Ga0081539_10000035
173 Ga0097621_100545783
174 Ga0075428_100013931
175 Ga0075428_100017153
176 Ga0075428_100307487
177 Ga0075431_100001066
178 Ga0075431_100013594
179 Ga0075433_10007093
180 Ga0075433_10139518
181 Ga0075434_100036273
182 Ga0075429_100183622
183 Ga0075429_100449626
184 Ga0075436_100071669
185 Ga0075435_100119953
186 Ga0075435_100713996
187 Ga0105240_10014143
188 Ga0111539_10016997
189 Ga0111539_11094786
190 Ga0114129_10000429
191 Ga0114129_10000549
192 Ga0114129_10002456
193 Ga0114129_10202595
194 Ga0114129_10393936
195 Ga0114129_11035005
196 Ga0105243_10585990
197 Ga0105242_10399088
198 Ga0105237_10000216
199 Ga0105238_10000018
200 Ga0105239_10043457
201 Ga0157373_10037808
202 Ga0157374_10000005
203 Ga0157374_10363292
204 Ga0157378_10053038
205 Ga0157378_10257886
206 Ga0157375_11275376
207 Ga0157380_10152077
208 Ga0157380_10917498
209 Ga0157377_10000001
210 Ga0213876_10000475
211 Ga0207684_10000177
212 Ga0207695_10045507
213 Ga0207671_10000247
214 Ga0207694_10000001
215 Ga0207709_10515323
216 Ga0207670_10028702
217 Ga0207651_10644035
218 Ga0207640_10065838
219 Ga0207708_10000005
220 Ga0207648_10079120
221 Ga0207428_10015071
222 Ga0207428_10085652
223 Ga0268264_10036141
224 Ga0265323_10017362
225 Ga0265330_10061935
226 Ga0265332_10189054
227 Ga0265329_10037496
228 Ga0265331_10059829
229 Ga0265316_10009912
230 Ga0265316_10032702
231 Ga0265316_10035640
232 Ga0265316_10337944
233 Ga0265314_10163905
234 Ga0307405_10083023
235 Ga0307406_10064477
236 Ga0307406_10108521
237 Ga0307407_10183159
238 Ga0307412_10215249
239 Ga0307409_100007881
240 Ga0307409_100033209
241 Ga0307409_100057177
242 Ga0395900_0065251
243 Ga0395898_0492337
244 Ga0395905_0402811
245 Ga0436364_0844863
246 Ga0400483_015735
247 Ga0400483_184174
248 Ga0400489_27327
249 Ga0436365_0039241
250 Ga0451577_0214426
251 Ga0453683_0065738
252 Ga0453683_0070562
253 Ga0453684_0468175
254 Ga0451576_0018791
255 Ga0501036_0168568
256 Ga0501038_0087402
257 Ga0501041_0047314
258 Ga0501042_0135269
259 Ga0501046_0082066
260 Ga0501048_0054017
261 Ga0501068_0111667
262 Ga0501072_0010506
263 Ga0501072_0084314
264 Ga0501072_0241286
265 Ga0501073_0265291
266 Ga0501075_0025690
267 Ga0501076_0007617
268 Ga0501077_0002006
269 Ga0501077_0176825
270 Ga0501079_0059699
271 Ga0501080_0121936
272 Ga0501081_0003553
273 Ga0501081_0072947
274 Ga0501045_0030772
275 Ga0501045_0202011
276 nmdc:mga05p37_14634_c1
277 nmdc:mga05p37_17270_c1
278 nmdc:mga05p37_2347_c1
279 nmdc:mga05p37_2727_c1
280 nmdc:mga05p37_334807_c1
281 nmdc:mga05p37_5073_c1
282 nmdc:mga09592_250762_c1
283 nmdc:mga09592_373290_c1
284 nmdc:mga09592_399076_c1
285 nmdc:mga09592_40245_c1
286 nmdc:mga0qj67_488353_c1
287 nmdc:mga06r32_344879_c1
288 nmdc:mga06r32_6598_c1
289 nmdc:mga08y16_10225_c1
290 nmdc:mga0n895_246_c1
291 nmdc:mga0n895_46771_c1
292 nmdc:mga0rr50_180476_c1
293 nmdc:mga0rr50_374755_c1
294 nmdc:mga08x19_902_c1
295 nmdc:mga0a205_5929_c1
296 nmdc:mga0a205_60313_c1
297 nmdc:mga0a205_653_c1
298 Ga0501084_0032577
299 Ga0501084_0250559
300 Ga0590074_011317
301 Ga0590075_028152
302 Ga0501082_0035214
303 Ga0501082_0175583
304 Ga0530510_0017678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

4

215

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.8492 1 208
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.8408 1 208
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.8106 1 208
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.8086 1 208
1v5x-assembly1.cif.gz_B crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus 0.8071 2 209
ID Description Score Start End Superfamily
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8247 2 207 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8135 2 207 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8071 2 209 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.801 1 207 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7995 2 209 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A402D2C2-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9356 1 213 GO:0000162
GO:0004640
GO:0006568
AF-A0A7W9STZ3-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9301 2 209 GO:0000162
GO:0004640
GO:0006568
AF-A0A402D2C2-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9269 1 213 GO:0000162
GO:0004640
GO:0006568
AF-A0A7W9STZ3-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9169 2 209 GO:0000162
GO:0004640
GO:0006568
AF-A0A2V5RBS2-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9132 127 215 GO:0000162
GO:0004640
GO:0006568

Map