F214826
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 152 | 37 | 304 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300033541|Ga0316596_1014179|Ga0316596_10141792 |
| Length | 338 |
| Sequence | MAGQVFAYIIHKEGKADDSAQELAVAAGKIFPDASPTAIVCGAGSDLDAVCSEVAALYKEVWKFDNEALAYPNAEAIRKLLVTVLPQDAVVLVPHDTFGMDLSPGLSIKLDSVFISDVVAFDGLDGDTLKVIRQEFSGQVSTHSSCDISTGAVINIRPGVFQVEESGAAAGGQVVDKSGDIPDLTVGRRFLEVVEAEVGDVDITKEDVLVSVGRGIEDEDNIEIADELAEAMGAVVSCSRPIVDAKWLEKSRQVGTSGQTVKPKVYLALGISGSFQHLGGLKGNPYIVAVNKNPKAPIFQVADVGVVQDLLEFVPVLTEKNTGKQITLGRKCLKFQNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 4 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 6 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 7 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 8 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 9 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 10 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 11 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 12 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 13 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 14 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 15 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 18 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 19 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 20 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 21 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 22 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 23 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 24 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 25 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 26 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 27 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 28 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 29 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 30 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 31 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 32 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 33 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 34 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 35 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 36 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 37 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.53 |
| Metatranscriptomes | 13.16 |
| Isolates | 1.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 68.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316596_1014179 | 3300033541 | Bacteria | 1974 |
| 2 | JGI25407J50210_10001242 | 3300003373 | Bacteria | 5697 |
| 3 | Ga0068864_100317595 | 3300005618 | Bacteria | 1462 |
| 4 | Ga0081538_10000337 | 3300005981 | Bacteria | 53196 |
| 5 | Ga0081538_10007773 | 3300005981 | Bacteria | 9216 |
| 6 | Ga0163163_10355863 | 3300014325 | Unclassified | 1520 |
| 7 | Ga0207711_10099081 | 3300025941 | Bacteria | 2576 |
| 8 | Ga0316575_10028382 | 3300031665 | Bacteria | 2182 |
| 9 | Ga0316579_10001311 | 3300031691 | Bacteria | 8988 |
| 10 | Ga0316579_10044934 | 3300031691 | Unclassified | 2058 |
| 11 | Ga0316579_10054099 | 3300031691 | Bacteria | 1881 |
| 12 | Ga0316579_10074338 | 3300031691 | Bacteria | 1614 |
| 13 | Ga0316576_10000099 | 3300031727 | Bacteria | 31461 |
| 14 | Ga0316576_10016395 | 3300031727 | Bacteria | 5002 |
| 15 | Ga0316576_10056770 | 3300031727 | Bacteria | 2860 |
| 16 | Ga0316576_10075855 | 3300031727 | Bacteria | 2487 |
| 17 | Ga0316576_10094334 | 3300031727 | Bacteria | 2231 |
| 18 | Ga0316576_10096507 | 3300031727 | Bacteria | 2206 |
| 19 | Ga0316576_10111874 | 3300031727 | Bacteria | 2047 |
| 20 | Ga0316576_10157389 | 3300031727 | Bacteria | 1713 |
| 21 | Ga0316576_10229189 | 3300031727 | Bacteria | 1397 |
| 22 | Ga0316576_10370905 | 3300031727 | Bacteria | 1063 |
| 23 | Ga0316578_10015007 | 3300031728 | Bacteria | 4155 |
| 24 | Ga0316578_10018843 | 3300031728 | Bacteria | 3790 |
| 25 | Ga0316578_10037711 | 3300031728 | Bacteria | 2785 |
| 26 | Ga0316578_10062508 | 3300031728 | Bacteria | 2195 |
| 27 | Ga0316578_10081944 | 3300031728 | Bacteria | 1920 |
| 28 | Ga0316578_10098175 | 3300031728 | Bacteria | 1755 |
| 29 | Ga0316578_10112185 | 3300031728 | Bacteria | 1638 |
| 30 | Ga0316578_10112727 | 3300031728 | Bacteria | 1634 |
| 31 | Ga0316578_10141030 | 3300031728 | Bacteria | 1452 |
| 32 | Ga0316577_10071186 | 3300031733 | Bacteria | 1940 |
| 33 | Ga0316577_10115133 | 3300031733 | Bacteria | 1509 |
| 34 | Ga0316577_10152511 | 3300031733 | Bacteria | 1302 |
| 35 | Ga0316583_10001184 | 3300032133 | Bacteria | 8551 |
| 36 | Ga0316583_10009841 | 3300032133 | Bacteria | 3445 |
| 37 | Ga0316583_10069568 | 3300032133 | Bacteria | 1231 |
| 38 | Ga0316583_10091453 | 3300032133 | Bacteria | 1061 |
| 39 | Ga0316585_10002095 | 3300032137 | Bacteria | 5358 |
| 40 | Ga0316580_10030477 | 3300032139 | Bacteria | 1670 |
| 41 | Ga0316593_10002372 | 3300032168 | Bacteria | 4438 |
| 42 | Ga0316593_10005721 | 3300032168 | Bacteria | 3306 |
| 43 | Ga0316593_10011908 | 3300032168 | Bacteria | 2540 |
| 44 | Ga0316593_10020843 | 3300032168 | Bacteria | 2043 |
| 45 | Ga0316593_10022249 | 3300032168 | Bacteria | 1990 |
| 46 | Ga0316593_10062021 | 3300032168 | Bacteria | 1280 |
| 47 | Ga0316593_10070360 | 3300032168 | Bacteria | 1209 |
| 48 | Ga0316588_1010872 | 3300033528 | Bacteria | 1929 |
| 49 | Ga0316588_1047877 | 3300033528 | Bacteria | 1033 |
| 50 | Ga0316596_1004392 | 3300033541 | Bacteria | 3159 |
| 51 | Ga0316596_1006370 | 3300033541 | Bacteria | 2743 |
| 52 | Ga0316596_1009288 | 3300033541 | Bacteria | 2358 |
| 53 | Ga0316596_1011980 | 3300033541 | Bacteria | 2127 |
| 54 | Ga0316596_1014978 | 3300033541 | Bacteria | 1929 |
| 55 | Ga0316596_1021348 | 3300033541 | Archaea | 1651 |
| 56 | Ga0316596_1026283 | 3300033541 | Bacteria | 1500 |
| 57 | Ga0316596_1047130 | 3300033541 | Bacteria | 1139 |
| 58 | Ga0316596_1049360 | 3300033541 | Bacteria | 1113 |
| 59 | Ga0316596_1051318 | 3300033541 | Bacteria | 1092 |
| 60 | Ga0373951_0022151 | 3300035091 | Bacteria | 1461 |
| 61 | Ga0316574_0000237 | 3300035398 | Bacteria | 19967 |
| 62 | Ga0316574_0006944 | 3300035398 | Bacteria | 6164 |
| 63 | Ga0316574_0007821 | 3300035398 | Bacteria | 5892 |
| 64 | Ga0316574_0018125 | 3300035398 | Bacteria | 4131 |
| 65 | Ga0316574_0215363 | 3300035398 | Bacteria | 1232 |
| 66 | Ga0316582_0011915 | 3300036647 | Bacteria | 4831 |
| 67 | Ga0316582_0026450 | 3300036647 | Bacteria | 3493 |
| 68 | Ga0316582_0046713 | 3300036647 | Bacteria | 2730 |
| 69 | Ga0316582_0047701 | 3300036647 | Bacteria | 2705 |
| 70 | Ga0316582_0136040 | 3300036647 | Bacteria | 1654 |
| 71 | Ga0316582_0139310 | 3300036647 | Unclassified | 1635 |
| 72 | Ga0316582_0145064 | 3300036647 | Bacteria | 1602 |
| 73 | Ga0316582_0149351 | 3300036647 | Bacteria | 1579 |
| 74 | Ga0316582_0175617 | 3300036647 | Unclassified | 1456 |
| 75 | Ga0316582_0294989 | 3300036647 | Unclassified | 1114 |
| 76 | Ga0316582_0374221 | 3300036647 | Bacteria | 980 |
| 77 | Ga0316584_0000700 | 3300036712 | Bacteria | 18570 |
| 78 | Ga0316584_0003841 | 3300036712 | Bacteria | 9850 |
| 79 | Ga0316584_0023000 | 3300036712 | Bacteria | 4550 |
| 80 | Ga0316584_0024019 | 3300036712 | Bacteria | 4457 |
| 81 | Ga0316584_0027714 | 3300036712 | Bacteria | 4171 |
| 82 | Ga0316584_0068723 | 3300036712 | Bacteria | 2655 |
| 83 | Ga0316584_0072137 | 3300036712 | Bacteria | 2588 |
| 84 | Ga0316584_0076638 | 3300036712 | Bacteria | 2505 |
| 85 | Ga0316584_0109843 | 3300036712 | Bacteria | 2063 |
| 86 | Ga0316584_0151913 | 3300036712 | Bacteria | 1723 |
| 87 | Ga0316581_0001301 | 3300037588 | Bacteria | 5547 |
| 88 | Ga0400484_03212 | 3300038725 | Bacteria | 6549 |
| 89 | Ga0400484_21344 | 3300038725 | Bacteria | 14441 |
| 90 | Ga0400490_03588 | 3300038726 | Bacteria | 18058 |
| 91 | Ga0400490_32210 | 3300038726 | Bacteria | 3452 |
| 92 | Ga0400490_35109 | 3300038726 | Bacteria | 1984 |
| 93 | Ga0400490_37139 | 3300038726 | Bacteria | 39208 |
| 94 | Ga0400491_02539 | 3300038727 | Bacteria | 2293 |
| 95 | Ga0400491_13864 | 3300038727 | Bacteria | 6266 |
| 96 | Ga0400485_02045 | 3300038735 | Bacteria | 7246 |
| 97 | Ga0400485_06211 | 3300038735 | Bacteria | 30943 |
| 98 | Ga0400485_06555 | 3300038735 | Bacteria | 71659 |
| 99 | Ga0400485_10030 | 3300038735 | Bacteria | 7022 |
| 100 | Ga0400485_19199 | 3300038735 | Bacteria | 7242 |
| 101 | Ga0400488_10169 | 3300038741 | Bacteria | 7748 |
| 102 | Ga0400488_11757 | 3300038741 | Bacteria | 1651 |
| 103 | Ga0400488_31787 | 3300038741 | Bacteria | 3796 |
| 104 | Ga0400488_37362 | 3300038741 | Bacteria | 1815 |
| 105 | Ga0400488_38676 | 3300038741 | Bacteria | 1406 |
| 106 | Ga0400486_03375 | 3300038742 | Bacteria | 25334 |
| 107 | Ga0400486_05265 | 3300038742 | Bacteria | 61476 |
| 108 | Ga0400486_14001 | 3300038742 | Bacteria | 7746 |
| 109 | Ga0400486_17803 | 3300038742 | Bacteria | 4224 |
| 110 | Ga0400486_22641 | 3300038742 | Bacteria | 32050 |
| 111 | Ga0400486_22976 | 3300038742 | Bacteria | 93315 |
| 112 | Ga0400483_014335 | 3300039062 | Bacteria | 2254 |
| 113 | Ga0400483_059416 | 3300039062 | Bacteria | 3814 |
| 114 | Ga0400483_059995 | 3300039062 | Bacteria | 1480 |
| 115 | Ga0400483_115138 | 3300039062 | Bacteria | 2381 |
| 116 | Ga0400483_117247 | 3300039062 | Bacteria | 4828 |
| 117 | Ga0400483_145723 | 3300039062 | Bacteria | 34433 |
| 118 | Ga0400483_199054 | 3300039062 | Bacteria | 2598 |
| 119 | Ga0400483_202262 | 3300039062 | Bacteria | 3975 |
| 120 | Ga0400483_207829 | 3300039062 | Bacteria | 67117 |
| 121 | Ga0400483_208358 | 3300039062 | Bacteria | 17273 |
| 122 | Ga0400483_242607 | 3300039062 | Bacteria | 2917 |
| 123 | Ga0400483_266432 | 3300039062 | Bacteria | 2017 |
| 124 | Ga0400489_03049 | 3300039093 | Bacteria | 14757 |
| 125 | Ga0400489_20945 | 3300039093 | Bacteria | 11502 |
| 126 | Ga0400489_28764 | 3300039093 | Bacteria | 8188 |
| 127 | Ga0400489_66913 | 3300039093 | Bacteria | 21932 |
| 128 | Ga0400489_82117 | 3300039093 | Bacteria | 39560 |
| 129 | Ga0400489_83876 | 3300039093 | Bacteria | 27736 |
| 130 | Ga0400489_90203 | 3300039093 | Bacteria | 38544 |
| 131 | Ga0400487_06228 | 3300039110 | Bacteria | 38638 |
| 132 | Ga0400487_09552 | 3300039110 | Bacteria | 12045 |
| 133 | Ga0400487_09880 | 3300039110 | Bacteria | 2255 |
| 134 | Ga0400487_21303 | 3300039110 | Bacteria | 74949 |
| 135 | Ga0451577_0003510 | 3300042876 | Bacteria | 17383 |
| 136 | Ga0451577_0008141 | 3300042876 | Bacteria | 10223 |
| 137 | Ga0451577_0013407 | 3300042876 | Bacteria | 7672 |
| 138 | Ga0451577_0086146 | 3300042876 | Bacteria | 2803 |
| 139 | Ga0451577_0365290 | 3300042876 | Bacteria | 1309 |
| 140 | Ga0453683_0177810 | 3300044673 | Bacteria | 1349 |
| 141 | Ga0453684_0002307 | 3300044712 | Bacteria | 46891 |
| 142 | Ga0453684_0003023 | 3300044712 | Bacteria | 39111 |
| 143 | Ga0453684_0029438 | 3300044712 | Bacteria | 7795 |
| 144 | Ga0453684_0094286 | 3300044712 | Bacteria | 3683 |
| 145 | Ga0453684_0098524 | 3300044712 | Bacteria | 3583 |
| 146 | Ga0453684_0147194 | 3300044712 | Bacteria | 2804 |
| 147 | Ga0453684_0190332 | 3300044712 | Bacteria | 2401 |
| 148 | Ga0453684_0507830 | 3300044712 | Bacteria | 1334 |
| 149 | Ga0451576_0033188 | 3300045051 | Bacteria | 5488 |
| 150 | Ga0501034_0004430 | 3300049571 | Bacteria | 15631 |
| 151 | 2585299658 | 2582581312 | Bacteria | 7308206 |
| 152 | 2740990453 | 2740891818 | Bacteria | 6711283 |
| 153 | Ga0316596_1014179 | |||
| 154 | JGI25407J50210_10001242 | |||
| 155 | Ga0068864_100317595 | |||
| 156 | Ga0081538_10000337 | |||
| 157 | Ga0081538_10007773 | |||
| 158 | Ga0163163_10355863 | |||
| 159 | Ga0207711_10099081 | |||
| 160 | Ga0316575_10028382 | |||
| 161 | Ga0316579_10001311 | |||
| 162 | Ga0316579_10044934 | |||
| 163 | Ga0316579_10054099 | |||
| 164 | Ga0316579_10074338 | |||
| 165 | Ga0316576_10000099 | |||
| 166 | Ga0316576_10016395 | |||
| 167 | Ga0316576_10056770 | |||
| 168 | Ga0316576_10075855 | |||
| 169 | Ga0316576_10094334 | |||
| 170 | Ga0316576_10096507 | |||
| 171 | Ga0316576_10111874 | |||
| 172 | Ga0316576_10157389 | |||
| 173 | Ga0316576_10229189 | |||
| 174 | Ga0316576_10370905 | |||
| 175 | Ga0316578_10015007 | |||
| 176 | Ga0316578_10018843 | |||
| 177 | Ga0316578_10037711 | |||
| 178 | Ga0316578_10062508 | |||
| 179 | Ga0316578_10081944 | |||
| 180 | Ga0316578_10098175 | |||
| 181 | Ga0316578_10112185 | |||
| 182 | Ga0316578_10112727 | |||
| 183 | Ga0316578_10141030 | |||
| 184 | Ga0316577_10071186 | |||
| 185 | Ga0316577_10115133 | |||
| 186 | Ga0316577_10152511 | |||
| 187 | Ga0316583_10001184 | |||
| 188 | Ga0316583_10009841 | |||
| 189 | Ga0316583_10069568 | |||
| 190 | Ga0316583_10091453 | |||
| 191 | Ga0316585_10002095 | |||
| 192 | Ga0316580_10030477 | |||
| 193 | Ga0316593_10002372 | |||
| 194 | Ga0316593_10005721 | |||
| 195 | Ga0316593_10011908 | |||
| 196 | Ga0316593_10020843 | |||
| 197 | Ga0316593_10022249 | |||
| 198 | Ga0316593_10062021 | |||
| 199 | Ga0316593_10070360 | |||
| 200 | Ga0316588_1010872 | |||
| 201 | Ga0316588_1047877 | |||
| 202 | Ga0316596_1004392 | |||
| 203 | Ga0316596_1006370 | |||
| 204 | Ga0316596_1009288 | |||
| 205 | Ga0316596_1011980 | |||
| 206 | Ga0316596_1014978 | |||
| 207 | Ga0316596_1021348 | |||
| 208 | Ga0316596_1026283 | |||
| 209 | Ga0316596_1047130 | |||
| 210 | Ga0316596_1049360 | |||
| 211 | Ga0316596_1051318 | |||
| 212 | Ga0373951_0022151 | |||
| 213 | Ga0316574_0000237 | |||
| 214 | Ga0316574_0006944 | |||
| 215 | Ga0316574_0007821 | |||
| 216 | Ga0316574_0018125 | |||
| 217 | Ga0316574_0215363 | |||
| 218 | Ga0316582_0011915 | |||
| 219 | Ga0316582_0026450 | |||
| 220 | Ga0316582_0046713 | |||
| 221 | Ga0316582_0047701 | |||
| 222 | Ga0316582_0136040 | |||
| 223 | Ga0316582_0139310 | |||
| 224 | Ga0316582_0145064 | |||
| 225 | Ga0316582_0149351 | |||
| 226 | Ga0316582_0175617 | |||
| 227 | Ga0316582_0294989 | |||
| 228 | Ga0316582_0374221 | |||
| 229 | Ga0316584_0000700 | |||
| 230 | Ga0316584_0003841 | |||
| 231 | Ga0316584_0023000 | |||
| 232 | Ga0316584_0024019 | |||
| 233 | Ga0316584_0027714 | |||
| 234 | Ga0316584_0068723 | |||
| 235 | Ga0316584_0072137 | |||
| 236 | Ga0316584_0076638 | |||
| 237 | Ga0316584_0109843 | |||
| 238 | Ga0316584_0151913 | |||
| 239 | Ga0316581_0001301 | |||
| 240 | Ga0400484_03212 | |||
| 241 | Ga0400484_21344 | |||
| 242 | Ga0400490_03588 | |||
| 243 | Ga0400490_32210 | |||
| 244 | Ga0400490_35109 | |||
| 245 | Ga0400490_37139 | |||
| 246 | Ga0400491_02539 | |||
| 247 | Ga0400491_13864 | |||
| 248 | Ga0400485_02045 | |||
| 249 | Ga0400485_06211 | |||
| 250 | Ga0400485_06555 | |||
| 251 | Ga0400485_10030 | |||
| 252 | Ga0400485_19199 | |||
| 253 | Ga0400488_10169 | |||
| 254 | Ga0400488_11757 | |||
| 255 | Ga0400488_31787 | |||
| 256 | Ga0400488_37362 | |||
| 257 | Ga0400488_38676 | |||
| 258 | Ga0400486_03375 | |||
| 259 | Ga0400486_05265 | |||
| 260 | Ga0400486_14001 | |||
| 261 | Ga0400486_17803 | |||
| 262 | Ga0400486_22641 | |||
| 263 | Ga0400486_22976 | |||
| 264 | Ga0400483_014335 | |||
| 265 | Ga0400483_059416 | |||
| 266 | Ga0400483_059995 | |||
| 267 | Ga0400483_115138 | |||
| 268 | Ga0400483_117247 | |||
| 269 | Ga0400483_145723 | |||
| 270 | Ga0400483_199054 | |||
| 271 | Ga0400483_202262 | |||
| 272 | Ga0400483_207829 | |||
| 273 | Ga0400483_208358 | |||
| 274 | Ga0400483_242607 | |||
| 275 | Ga0400483_266432 | |||
| 276 | Ga0400489_03049 | |||
| 277 | Ga0400489_20945 | |||
| 278 | Ga0400489_28764 | |||
| 279 | Ga0400489_66913 | |||
| 280 | Ga0400489_82117 | |||
| 281 | Ga0400489_83876 | |||
| 282 | Ga0400489_90203 | |||
| 283 | Ga0400487_06228 | |||
| 284 | Ga0400487_09552 | |||
| 285 | Ga0400487_09880 | |||
| 286 | Ga0400487_21303 | |||
| 287 | Ga0451577_0003510 | |||
| 288 | Ga0451577_0008141 | |||
| 289 | Ga0451577_0013407 | |||
| 290 | Ga0451577_0086146 | |||
| 291 | Ga0451577_0365290 | |||
| 292 | Ga0453683_0177810 | |||
| 293 | Ga0453684_0002307 | |||
| 294 | Ga0453684_0003023 | |||
| 295 | Ga0453684_0029438 | |||
| 296 | Ga0453684_0094286 | |||
| 297 | Ga0453684_0098524 | |||
| 298 | Ga0453684_0147194 | |||
| 299 | Ga0453684_0190332 | |||
| 300 | Ga0453684_0507830 | |||
| 301 | Ga0451576_0033188 | |||
| 302 | Ga0501034_0004430 | |||
| 303 | 2585299658 | |||
| 304 | 2740990453 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.9431 | 2 | 188 |
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.9288 | 2 | 188 |
| 3ih5-assembly1.cif.gz_B | crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron | 0.8359 | 1 | 191 |
| 3cls-assembly1.cif.gz_D | crystal structure of the r236c mutant of etf from methylophilus methylotrophus | 0.8051 | 2 | 315 |
| 3clr-assembly1.cif.gz_D | crystal structure of the r236a etf mutant from m. methylotrophus | 0.8047 | 2 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77378_184_312_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9662 | 193 | 314 | 3.40.50.1220 |
| 1o97D02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9652 | 193 | 315 | 3.40.50.1220 |
| af_Q46907_159_286_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9483 | 197 | 314 | 3.40.50.1220 |
| 1o97D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9435 | 2 | 188 | 3.40.50.620 |
| 1o97D02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9355 | 193 | 315 | 3.40.50.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645JL13-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9822 | 223 | 314 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A800HBP4-F1-model_v4 | Electron transfer flavoprotein subunit alpha/FixB family protein | 0.9776 | 220 | 314 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A257V656-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9759 | 227 | 314 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-T0XXZ4-F1-model_v4 | Electron transfer flavoprotein alpha subunit | 0.9757 | 198 | 314 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A2V6VSR4-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9749 | 222 | 314 |
GO:0009055
GO:0033539 GO:0050660 |