F214769

General Info

Members Datasets Scaffolds Average Seq Length
152 46 136 494

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10002617|Ga0316578_100026175
Length 526
Sequence MILPFDTRLPPDALLPLLVLASSLLPGLVIFFLAEQRVRLRTLLNLGGASIKLGLVAWMLWGVYHGRSYAARLPLVDGLDLALEVGPLSLLFLILSAGLWLVTTVYAVGYLEESPNRSRFFGFFSLCVTATVGVAMAGNLLTFLLFFEMLTLTTYPLVMHRGSEAARRAGTVYLAHTMFAGALLLAGTVWLYVLAGTLTFTPRGFVADIAETRPGTLTAIFALLIGGVGVKAALVPLHSWLPRAMVAPAPVSALLHAVAVVKAGAFGVVLIVYDVFGVEQAAELGVTGPLALVAAVTILYGSLRALFQDDLKRRLAFSTVSQVSYIVLGVAIVGPLASTGGIVHLVHQGIMKITLFFCAGNLAETLGIHKISEMNGVGRRMPWTMGAFSVAALGMIGVPPIAGFITKWYLGLGALEAGLHWPLYVLTASSLLNAAYFLPILHAAWLREPTTPWAESAPGARPAAPAADGTRWPLAGWWTRPETGWLLLLPPLVTAALSLLIGLLASSPFSPLEWSLLIAEREFQYP

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
3 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
4 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
5 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
6 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
7 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
8 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
9 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
10 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
11 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
12 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
13 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
14 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
17 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
18 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
19 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
20 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
21 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
22 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
23 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
24 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
25 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
29 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
30 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
31 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
32 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
33 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
34 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
35 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
36 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
37 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
38 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
41 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
42 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
44 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
45 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
46 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.84
Metatranscriptomes 2.63
Isolates 10.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 81.58
Stem 0
Stem Tuber 0.66
Unclassified 17.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10298540 3300013307 Bacteria 1874
2 Ga0316575_10001359 3300031665 Bacteria 7852
3 Ga0316575_10003633 3300031665 Bacteria 5351
4 Ga0316575_10005953 3300031665 Bacteria 4363
5 Ga0316575_10016651 3300031665 Bacteria 2784
6 Ga0316575_10019527 3300031665 Bacteria 2593
7 Ga0316575_10025112 3300031665 Bacteria 2309
8 Ga0316579_10001050 3300031691 Bacteria 9751
9 Ga0316579_10001571 3300031691 Bacteria 8331
10 Ga0316579_10005536 3300031691 Bacteria 5107
11 Ga0316579_10009238 3300031691 Bacteria 4142
12 Ga0316579_10009335 3300031691 Bacteria 4121
13 Ga0316579_10033580 3300031691 Bacteria 2357
14 Ga0316579_10035947 3300031691 Bacteria 2284
15 Ga0316579_10065952 3300031691 Bacteria 1709
16 Ga0316576_10000126 3300031727 Bacteria 29047
17 Ga0316576_10000851 3300031727 Bacteria 15482
18 Ga0316576_10004890 3300031727 Bacteria 8102
19 Ga0316576_10006170 3300031727 Bacteria 7433
20 Ga0316576_10012257 3300031727 Bacteria 5658
21 Ga0316576_10013387 3300031727 Bacteria 5451
22 Ga0316576_10014292 3300031727 Bacteria 5303
23 Ga0316576_10014507 3300031727 Bacteria 5264
24 Ga0316576_10014765 3300031727 Bacteria 5222
25 Ga0316576_10014852 3300031727 Bacteria 5209
26 Ga0316576_10017365 3300031727 Bacteria 4886
27 Ga0316576_10024886 3300031727 Bacteria 4185
28 Ga0316576_10099715 3300031727 Bacteria 2170
29 Ga0316576_10135684 3300031727 Bacteria 1852
30 Ga0316578_10000001 3300031728 Bacteria 72102
31 Ga0316578_10000147 3300031728 Bacteria 18381
32 Ga0316578_10002617 3300031728 Bacteria 7976
33 Ga0316578_10003710 3300031728 Bacteria 7053
34 Ga0316578_10004298 3300031728 Bacteria 6693
35 Ga0316578_10004746 3300031728 Bacteria 6471
36 Ga0316578_10005299 3300031728 Bacteria 6233
37 Ga0316578_10019439 3300031728 Bacteria 3739
38 Ga0316578_10022366 3300031728 Bacteria 3523
39 Ga0316578_10027423 3300031728 Bacteria 3220
40 Ga0316578_10028602 3300031728 Bacteria 3158
41 Ga0316578_10042659 3300031728 Bacteria 2631
42 Ga0316578_10043233 3300031728 Bacteria 2616
43 Ga0316578_10057401 3300031728 Bacteria 2287
44 Ga0316578_10094064 3300031728 Bacteria 1792
45 Ga0316577_10001737 3300031733 Bacteria 10474
46 Ga0316577_10004475 3300031733 Bacteria 7215
47 Ga0316577_10006707 3300031733 Bacteria 6104
48 Ga0316577_10011561 3300031733 Bacteria 4783
49 Ga0316577_10023298 3300031733 Bacteria 3438
50 Ga0316577_10029142 3300031733 Bacteria 3081
51 Ga0316577_10045734 3300031733 Bacteria 2446
52 Ga0316577_10056798 3300031733 Bacteria 2185
53 Ga0307410_10128985 3300031852 Bacteria 1855
54 Ga0316583_10000825 3300032133 Bacteria 9845
55 Ga0316583_10002865 3300032133 Bacteria 6051
56 Ga0316583_10036435 3300032133 Bacteria 1745
57 Ga0316585_10000695 3300032137 Bacteria 8395
58 Ga0316585_10001687 3300032137 Bacteria 5866
59 Ga0316585_10016186 3300032137 Bacteria 2243
60 Ga0316585_10021656 3300032137 Bacteria 1975
61 Ga0316580_10001128 3300032139 Bacteria 6760
62 Ga0316580_10003787 3300032139 Bacteria 4330
63 Ga0316580_10008718 3300032139 Unclassified 3043
64 Ga0316580_10009447 3300032139 Bacteria 2931
65 Ga0316580_10011388 3300032139 Bacteria 2700
66 Ga0316580_10015058 3300032139 Bacteria 2363
67 Ga0316593_10014898 3300032168 Bacteria 2329
68 Ga0316593_10021940 3300032168 Bacteria 2001
69 Ga0316592_1000261 3300033524 Bacteria 6559
70 Ga0316596_1000505 3300033541 Bacteria 6649
71 Ga0316574_0001154 3300035398 Bacteria 12178
72 Ga0316574_0001478 3300035398 Bacteria 11191
73 Ga0316574_0002327 3300035398 Bacteria 9484
74 Ga0316574_0003930 3300035398 Bacteria 7727
75 Ga0316574_0005257 3300035398 Bacteria 6892
76 Ga0316574_0012514 3300035398 Bacteria 4855
77 Ga0316574_0015591 3300035398 Bacteria 4411
78 Ga0316574_0028258 3300035398 Bacteria 3381
79 Ga0316574_0029529 3300035398 Bacteria 3313
80 Ga0316574_0029850 3300035398 Bacteria 3297
81 Ga0316574_0055299 3300035398 Bacteria 2480
82 Ga0316574_0134662 3300035398 Bacteria 1591
83 Ga0316582_0000034 3300036647 Bacteria 31889
84 Ga0316582_0004564 3300036647 Bacteria 7014
85 Ga0316582_0005075 3300036647 Bacteria 6735
86 Ga0316582_0010183 3300036647 Bacteria 5138
87 Ga0316582_0013261 3300036647 Bacteria 4633
88 Ga0316582_0013786 3300036647 Bacteria 4562
89 Ga0316582_0014098 3300036647 Bacteria 4525
90 Ga0316582_0021347 3300036647 Bacteria 3823
91 Ga0316582_0034122 3300036647 Bacteria 3131
92 Ga0316582_0062821 3300036647 Bacteria 2385
93 Ga0316582_0073465 3300036647 Bacteria 2219
94 Ga0316582_0077657 3300036647 Bacteria 2161
95 Ga0316584_0000329 3300036712 Bacteria 24394
96 Ga0316584_0000943 3300036712 Bacteria 16588
97 Ga0316584_0002512 3300036712 Bacteria 11618
98 Ga0316584_0003531 3300036712 Bacteria 10195
99 Ga0316584_0006605 3300036712 Bacteria 7859
100 Ga0316584_0006940 3300036712 Bacteria 7700
101 Ga0316584_0015463 3300036712 Bacteria 5459
102 Ga0316584_0018068 3300036712 Bacteria 5083
103 Ga0316584_0018234 3300036712 Bacteria 5061
104 Ga0316584_0019680 3300036712 Bacteria 4881
105 Ga0316584_0027462 3300036712 Bacteria 4189
106 Ga0316584_0043896 3300036712 Bacteria 3334
107 Ga0316584_0044695 3300036712 Bacteria 3304
108 Ga0316584_0044894 3300036712 Bacteria 3297
109 Ga0316584_0091351 3300036712 Bacteria 2279
110 Ga0316584_0127727 3300036712 Bacteria 1899
111 Ga0316581_0003370 3300037588 Bacteria 3973
112 Ga0400484_18313 3300038725 Bacteria 9610
113 Ga0400490_23988 3300038726 Bacteria 13614
114 Ga0400490_50525 3300038726 Unclassified 1785
115 Ga0400485_16091 3300038735 Bacteria 11514
116 Ga0400485_21592 3300038735 Bacteria 15450
117 Ga0400488_14685 3300038741 Bacteria 5314
118 Ga0400486_15780 3300038742 Bacteria 5993
119 Ga0400486_26581 3300038742 Bacteria 17802
120 Ga0400483_046771 3300039062 Bacteria 7893
121 Ga0400483_057873 3300039062 Bacteria 24525
122 Ga0400483_121972 3300039062 Bacteria 3797
123 Ga0400483_177015 3300039062 Bacteria 39327
124 Ga0400483_184460 3300039062 Bacteria 6330
125 Ga0400483_197032 3300039062 Bacteria 5627
126 Ga0400483_208983 3300039062 Bacteria 4024
127 Ga0400483_246914 3300039062 Bacteria 10247
128 Ga0400483_254969 3300039062 Bacteria 18202
129 Ga0400487_30797 3300039110 Bacteria 14421
130 Ga0400487_40075 3300039110 Bacteria 7162
131 Ga0439449_0006840 3300042007 Bacteria 4349
132 Ga0453684_0003093 3300044712 Bacteria 38362
133 Ga0501034_0043193 3300049571 Bacteria 4563
134 Ga0501040_0055690 3300049576 Bacteria 2712
135 Ga0501081_0093152 3300049743 Bacteria 2121
136 Ga0501045_0083121 3300049824 Bacteria 2362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038726 Ga0400490_50525 Ga0400490_50525_59_1561 448
2 3300035398 Ga0316574_0055299 Ga0316574_0055299_19_1428 454
3 3300032139 Ga0316580_10011388 Ga0316580_100113882 456
4 3300031665 Ga0316575_10003633 Ga0316575_100036333 458
5 3300031691 Ga0316579_10001050 Ga0316579_100010504 458
6 3300031727 Ga0316576_10000126 Ga0316576_1000012616 458
7 3300031728 Ga0316578_10000001 Ga0316578_100000018 458
8 3300031733 Ga0316577_10001737 Ga0316577_100017374 458
9 3300032137 Ga0316585_10000695 Ga0316585_100006954 458
10 3300035398 Ga0316574_0001154 Ga0316574_0001154_1400_2899 458
11 3300036647 Ga0316582_0000034 Ga0316582_0000034_18700_20199 458
12 3300036712 Ga0316584_0002512 Ga0316584_0002512_6223_7722 458
13 3300049571 Ga0501034_0043193 Ga0501034_0043193_2345_3826 462
14 3300035398 Ga0316574_0001478 Ga0316574_0001478_1662_3125 469
15 3300036647 Ga0316582_0005075 Ga0316582_0005075_1034_2497 469
16 3300036712 Ga0316584_0044894 Ga0316584_0044894_801_2264 469
17 3300039062 Ga0400483_046771 Ga0400483_046771_2344_3795 472
18 3300039062 Ga0400483_177015 Ga0400483_177015_2113_3564 472
19 3300031691 Ga0316579_10009238 Ga0316579_100092384 474
20 3300031727 Ga0316576_10014507 Ga0316576_100145074 474
21 3300031728 Ga0316578_10003710 Ga0316578_100037102 474
22 3300036712 Ga0316584_0019680 Ga0316584_0019680_901_2409 474
23 iso_pu_bacteria 3000405567 3000408619 474
24 3300036647 Ga0316582_0013786 Ga0316582_0013786_389_1891 475
25 3300036712 Ga0316584_0015463 Ga0316584_0015463_3767_5269 475
26 3300036712 Ga0316584_0018068 Ga0316584_0018068_1966_3462 475
27 iso_pu_bacteria 2855020534 2855022247 475
28 iso_pu_bacteria 2917554339 2917558708 475
29 3300031691 Ga0316579_10065952 Ga0316579_100659521 476
30 3300032139 Ga0316580_10001128 Ga0316580_100011283 476
31 3300032168 Ga0316593_10014898 Ga0316593_100148982 476
32 3300032168 Ga0316593_10021940 Ga0316593_100219402 476
33 3300033524 Ga0316592_1000261 Ga0316592_10002613 476
34 3300033541 Ga0316596_1000505 Ga0316596_10005052 476
35 3300035398 Ga0316574_0005257 Ga0316574_0005257_3791_5296 476
36 3300036647 Ga0316582_0010183 Ga0316582_0010183_2022_3527 476
37 3300036647 Ga0316582_0077657 Ga0316582_0077657_293_1798 476
38 3300036712 Ga0316584_0091351 Ga0316584_0091351_729_2234 476
39 iso_pu_bacteria 2657244999 2657686198 476
40 iso_pu_bacteria 2802429268 2804755106 476
41 iso_pu_bacteria 2881101125 2881101131 476
42 iso_pu_bacteria 2899275550 2899277238 476
43 3300031727 Ga0316576_10006170 Ga0316576_100061702 477
44 3300031728 Ga0316578_10000147 Ga0316578_1000014718 477
45 3300031733 Ga0316577_10004475 Ga0316577_100044752 477
46 3300031733 Ga0316577_10006707 Ga0316577_100067072 477
47 3300036712 Ga0316584_0000329 Ga0316584_0000329_9964_11454 477
48 3300031852 Ga0307410_10128985 Ga0307410_101289852 478
49 3300031665 Ga0316575_10025112 Ga0316575_100251122 479
50 3300031727 Ga0316576_10004890 Ga0316576_1000489010 479
51 3300031728 Ga0316578_10004298 Ga0316578_100042988 479
52 3300032133 Ga0316583_10036435 Ga0316583_100364352 479
53 3300035398 Ga0316574_0002327 Ga0316574_0002327_5738_7204 479
54 3300036647 Ga0316582_0014098 Ga0316582_0014098_887_2353 479
55 3300036712 Ga0316584_0006605 Ga0316584_0006605_4906_6372 479
56 3300049576 Ga0501040_0055690 Ga0501040_0055690_1026_2492 479
57 3300049743 Ga0501081_0093152 Ga0501081_0093152_14_1480 479
58 3300035398 Ga0316574_0134662 Ga0316574_0134662_42_1490 480
59 iso_pu_bacteria 2728369097 2729146636 480
60 iso_pu_bacteria 640427133 640486340 480
61 iso_pu_bacteria 651053060 651174305 480
62 iso_pu_bacteria 2522572158 2523106418 481
63 3300035398 Ga0316574_0015591 Ga0316574_0015591_994_2448 482
64 iso_pu_bacteria 2974294766 2974295815 482
65 iso_pu_bacteria 2974324384 2974324386 482
66 3300031727 Ga0316576_10000851 Ga0316576_100008519 483
67 3300031728 Ga0316578_10042659 Ga0316578_100426592 483
68 3300039062 Ga0400483_208983 Ga0400483_208983_635_2131 483
69 iso_pu_bacteria 2919534386 2919535854 483
70 iso_pu_bacteria 2932398195 2932400188 484
71 3300031665 Ga0316575_10001359 Ga0316575_100013594 485
72 3300031665 Ga0316575_10005953 Ga0316575_100059534 485
73 3300031665 Ga0316575_10016651 Ga0316575_100166512 485
74 3300031665 Ga0316575_10019527 Ga0316575_100195271 485
75 3300031691 Ga0316579_10001571 Ga0316579_1000157110 485
76 3300031691 Ga0316579_10005536 Ga0316579_100055367 485
77 3300031691 Ga0316579_10009335 Ga0316579_100093352 485
78 3300031691 Ga0316579_10033580 Ga0316579_100335802 485
79 3300031691 Ga0316579_10035947 Ga0316579_100359472 485
80 3300031727 Ga0316576_10012257 Ga0316576_100122576 485
81 3300031727 Ga0316576_10013387 Ga0316576_100133872 485
82 3300031727 Ga0316576_10014292 Ga0316576_100142925 485
83 3300031727 Ga0316576_10014765 Ga0316576_100147651 485
84 3300031727 Ga0316576_10014852 Ga0316576_100148524 485
85 3300031727 Ga0316576_10017365 Ga0316576_100173653 485
86 3300031727 Ga0316576_10024886 Ga0316576_100248862 485
87 3300031727 Ga0316576_10099715 Ga0316576_100997152 485
88 3300031727 Ga0316576_10135684 Ga0316576_101356842 485
89 3300031728 Ga0316578_10002617 Ga0316578_100026175 485
90 3300031728 Ga0316578_10004746 Ga0316578_100047463 485
91 3300031728 Ga0316578_10005299 Ga0316578_100052996 485
92 3300031728 Ga0316578_10019439 Ga0316578_100194392 485
93 3300031728 Ga0316578_10022366 Ga0316578_100223662 485
94 3300031728 Ga0316578_10027423 Ga0316578_100274232 485
95 3300031728 Ga0316578_10028602 Ga0316578_100286022 485
96 3300031728 Ga0316578_10043233 Ga0316578_100432331 485
97 3300031728 Ga0316578_10094064 Ga0316578_100940642 485
98 3300031733 Ga0316577_10011561 Ga0316577_100115612 485
99 3300031733 Ga0316577_10023298 Ga0316577_100232982 485
100 3300031733 Ga0316577_10029142 Ga0316577_100291422 485
101 3300031733 Ga0316577_10045734 Ga0316577_100457342 485
102 3300031733 Ga0316577_10056798 Ga0316577_100567982 485
103 3300032133 Ga0316583_10000825 Ga0316583_100008259 485
104 3300032137 Ga0316585_10001687 Ga0316585_100016879 485
105 3300032137 Ga0316585_10016186 Ga0316585_100161862 485
106 3300032137 Ga0316585_10021656 Ga0316585_100216562 485
107 3300032139 Ga0316580_10003787 Ga0316580_100037873 485
108 3300032139 Ga0316580_10009447 Ga0316580_100094471 485
109 3300032139 Ga0316580_10015058 Ga0316580_100150582 485
110 3300035398 Ga0316574_0003930 Ga0316574_0003930_1564_3066 485
111 3300035398 Ga0316574_0012514 Ga0316574_0012514_182_1687 485
112 3300035398 Ga0316574_0028258 Ga0316574_0028258_514_2016 485
113 3300035398 Ga0316574_0029529 Ga0316574_0029529_1254_2756 485
114 3300035398 Ga0316574_0029850 Ga0316574_0029850_814_2316 485
115 3300036647 Ga0316582_0004564 Ga0316582_0004564_3496_4998 485
116 3300036647 Ga0316582_0013261 Ga0316582_0013261_1648_3153 485
117 3300036647 Ga0316582_0021347 Ga0316582_0021347_1859_3361 485
118 3300036647 Ga0316582_0034122 Ga0316582_0034122_1404_2909 485
119 3300036647 Ga0316582_0062821 Ga0316582_0062821_401_1912 485
120 3300036647 Ga0316582_0073465 Ga0316582_0073465_27_1526 485
121 3300036712 Ga0316584_0000943 Ga0316584_0000943_9881_11386 485
122 3300036712 Ga0316584_0003531 Ga0316584_0003531_4904_6406 485
123 3300036712 Ga0316584_0006940 Ga0316584_0006940_2608_4188 485
124 3300036712 Ga0316584_0018234 Ga0316584_0018234_365_1864 485
125 3300036712 Ga0316584_0027462 Ga0316584_0027462_22_1524 485
126 3300036712 Ga0316584_0043896 Ga0316584_0043896_419_1939 485
127 3300036712 Ga0316584_0044695 Ga0316584_0044695_85_1599 485
128 3300036712 Ga0316584_0127727 Ga0316584_0127727_60_1607 485
129 3300037588 Ga0316581_0003370 Ga0316581_0003370_551_2053 485
130 3300038725 Ga0400484_18313 Ga0400484_18313_4933_6435 485
131 3300038726 Ga0400490_23988 Ga0400490_23988_7834_9336 485
132 3300038735 Ga0400485_16091 Ga0400485_16091_3992_5494 485
133 3300038735 Ga0400485_21592 Ga0400485_21592_9418_10920 485
134 3300038741 Ga0400488_14685 Ga0400488_14685_1873_3375 485
135 3300038742 Ga0400486_15780 Ga0400486_15780_507_2009 485
136 3300038742 Ga0400486_26581 Ga0400486_26581_6950_8452 485
137 3300039062 Ga0400483_057873 Ga0400483_057873_5108_6610 485
138 3300039062 Ga0400483_121972 Ga0400483_121972_314_1816 485
139 3300039062 Ga0400483_197032 Ga0400483_197032_3841_5343 485
140 3300039062 Ga0400483_246914 Ga0400483_246914_8302_9807 485
141 3300039062 Ga0400483_254969 Ga0400483_254969_16549_18054 485
142 3300039110 Ga0400487_30797 Ga0400487_30797_2420_3922 485
143 3300039110 Ga0400487_40075 Ga0400487_40075_4468_5970 485
144 3300042007 Ga0439449_0006840 Ga0439449_0006840_2038_3549 485
145 3300044712 Ga0453684_0003093 Ga0453684_0003093_1189_2685 485
146 iso_pu_bacteria 2984580707 2984582431 485
147 3300032133 Ga0316583_10002865 Ga0316583_100028655 486
148 3300039062 Ga0400483_184460 Ga0400483_184460_2562_4049 486
149 3300032139 Ga0316580_10008718 Ga0316580_100087182 487
150 3300031728 Ga0316578_10057401 Ga0316578_100574012 490
151 3300049824 Ga0501045_0083121 Ga0501045_0083121_688_2163 490
152 3300013307 Ga0157372_10298540 Ga0157372_102985402 491

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00662

Proton_antipo_N

NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus

77

121

0.97

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

137

433

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o6y-assembly1.cif.gz_5 cryo-em structure of respiratory complex i under turnover 0.9066 10 478
6u8y-assembly1.cif.gz_h structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.9051 11 486
7b0n-assembly1.cif.gz_L a 3.7-angstrom structure of yarrowia lipolytica complex i with an r121m mutation in nucm. 0.9043 10 471
6tjv-assembly1.cif.gz_D structure of the ndh-1ms complex from thermosynechococcus elongatus 0.8948 11 487
8e9h-assembly1.cif.gz_L mycobacterial respiratory complex i, fully-inserted quinone 0.8942 11 487
ID Description Score Start End Superfamily
af_P9WIX3_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8715 116 197 1.10.287.3510
af_Q2G2H7_1_127_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8406 7 132 1.20.1070.10
af_P23482_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8307 7 132 1.20.1070.10
af_Q2G212_1_126_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8307 7 129 1.20.1070.10
af_Q2G2H7_1_127_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8166 7 132 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7W0FE63-F1-model_v4 Monovalent cation/H+ antiporter subunit D family protein 0.9845 10 157 GO:0016020
AF-A0A2S6R4B1-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9744 62 487 GO:0005886
GO:0016491
AF-A0A848YIP7-F1-model_v4 Monovalent cation/H+ antiporter subunit D family protein 0.9728 81 489 GO:0005886
AF-A0A8B6S9M6-F1-model_v4 deleted 0.9704 10 372
AF-S3IBH8-F1-model_v4 Monovalent cation/H+ antiporter subunit D 0.9698 10 487 GO:0012505
GO:0016020

Feature Viewer

pLDDT pTM Quality
92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map