F213924

General Info

Members Datasets Scaffolds Average Seq Length
152 130 132 333

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1010012|Ga0081540_10100122
Length 361
Sequence MPLFRDGKRILRRSGYVVATLARQLAVKSRLVAVFTGAVLGLIAGAGSLSQASAQGDPLPSWNDTAAKRTIIEFVDRTTTSGGPDFVPPAERIATFDNDGTLWCEQPVYFQLAFAIDQVKALAPKHPEWKTQQPFKALLEKDMKGVGAAGKTGLLQIMAATHTGMTTDEFSRSVRDWLATAKHPRFNRPFDSLVYQPMLELLAYLRANGFKTFIVSGGGIEFMRPWMEKTYGIPPEQVVGSSGVVKFQTGADGKPELIKLAKMEFVDDGPGKPVGINRFIGRRPILAFGNSDGDLQMLQWTVAGRGARLAALLHHTDAEREYAYDRQSKIGKLDKALDEATARGWTVVDMKRDWKAVFPEK

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
7 2791355199
8 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
9 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
10 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
11 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
12 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
13 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
14 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
15 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
69 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
72 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
110 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
111 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
115 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
116 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
117 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
118 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
123 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
126 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
127 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
128 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
129 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
130 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.09
Metatranscriptomes 1.32
Isolates 12.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.16
Nodule 8.55
Rhizoplane 2.63
Rhizosphere 67.11
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10017459 3300001991 Unclassified 1347
2 Ga0070658_10139385 3300005327 Bacteria 2025
3 Ga0070670_100000035 3300005331 Bacteria 157570
4 Ga0070691_10011107 3300005341 Bacteria 4110
5 Ga0070661_100102197 3300005344 Bacteria 2133
6 Ga0070668_100003075 3300005347 Bacteria 12336
7 Ga0070669_100110884 3300005353 Bacteria 2082
8 Ga0070667_100001410 3300005367 Bacteria 21500
9 Ga0070700_100012140 3300005441 Bacteria 4795
10 Ga0070694_100085716 3300005444 Bacteria 2200
11 Ga0070695_100008563 3300005545 Bacteria 6075
12 Ga0070665_100016403 3300005548 Bacteria 7429
13 Ga0070664_100088333 3300005564 Bacteria 2680
14 Ga0068856_100177082 3300005614 Bacteria 2145
15 Ga0068859_100117744 3300005617 Bacteria 2722
16 Ga0068864_100001144 3300005618 Bacteria 22133
17 Ga0068863_100002037 3300005841 Bacteria 20029
18 Ga0068862_100000368 3300005844 Bacteria 48907
19 Ga0081455_10033612 3300005937 Bacteria 4606
20 Ga0081538_10021746 3300005981 Bacteria 4668
21 Ga0081540_1010012 3300005983 Bacteria 6452
22 Ga0081540_1024072 3300005983 Bacteria 3542
23 Ga0081540_1031192 3300005983 Bacteria 2936
24 Ga0097621_100246272 3300006237 Bacteria 1564
25 Ga0097620_100117745 3300006931 Bacteria 2722
26 Ga0105247_10003643 3300009101 Bacteria 10008
27 Ga0105247_10076177 3300009101 Bacteria 2106
28 Ga0105248_10007747 3300009177 Bacteria 11793
29 Ga0105237_10165888 3300009545 Bacteria 2208
30 Ga0105249_10000525 3300009553 Bacteria 35250
31 Ga0157369_10002444 3300013105 Bacteria 22316
32 Ga0157378_10378243 3300013297 Bacteria 1390
33 Ga0163162_10075328 3300013306 Bacteria 3435
34 Ga0157379_10003228 3300014968 Bacteria 13814
35 Ga0209256_1000641 3300025299 Bacteria 47608
36 Ga0207710_10072285 3300025900 Bacteria 1584
37 Ga0207649_10071943 3300025920 Bacteria 2211
38 Ga0207649_10100014 3300025920 Bacteria 1917
39 Ga0207650_10000350 3300025925 Bacteria 44409
40 Ga0207664_10016924 3300025929 Bacteria 5332
41 Ga0207711_10015908 3300025941 Bacteria 6239
42 Ga0207661_10185865 3300025944 Bacteria 1818
43 Ga0207712_10002507 3300025961 Bacteria 11815
44 Ga0207668_10000035 3300025972 Bacteria 119182
45 Ga0207658_10000300 3300025986 Bacteria 51413
46 Ga0207702_10214179 3300026078 Bacteria 1792
47 Ga0207641_10006570 3300026088 Bacteria 9773
48 Ga0207676_10000970 3300026095 Bacteria 22157
49 Ga0268266_10004822 3300028379 Bacteria 12803
50 Ga0268265_10010277 3300028380 Bacteria 6321
51 Ga0307513_10094960 3300031456 Bacteria 3025
52 Ga0316575_10000886 3300031665 Bacteria 9188
53 Ga0316575_10012338 3300031665 Bacteria 3177
54 Ga0316575_10016836 3300031665 Bacteria 2770
55 Ga0316575_10026970 3300031665 Bacteria 2234
56 Ga0316579_10079249 3300031691 Bacteria 1563
57 Ga0316576_10000302 3300031727 Bacteria 21794
58 Ga0316576_10109461 3300031727 Bacteria 2070
59 Ga0316576_10222645 3300031727 Unclassified 1419
60 Ga0316578_10052161 3300031728 Bacteria 2396
61 Ga0316578_10072549 3300031728 Bacteria 2039
62 Ga0316577_10005716 3300031733 Bacteria 6532
63 Ga0316577_10040151 3300031733 Bacteria 2618
64 Ga0315911_1000007 3300033442 Bacteria 413725
65 Ga0316588_1021603 3300033528 Bacteria 1465
66 Ga0316596_1028420 3300033541 Bacteria 1445
67 Ga0373950_0008422 3300034818 Bacteria 1623
68 Ga0373940_0039198 3300035088 Bacteria 1296
69 Ga0316574_0001009 3300035398 Bacteria 12692
70 Ga0373931_0032794 3300035691 Bacteria 2689
71 Ga0316582_0009577 3300036647 Bacteria 5263
72 Ga0316582_0123117 3300036647 Bacteria 1737
73 Ga0316582_0160172 3300036647 Bacteria 1524
74 Ga0316584_0080539 3300036712 Bacteria 2439
75 Ga0316581_0053162 3300037588 Bacteria 1241
76 Ga0451577_0092933 3300042876 Bacteria 2693
77 Ga0453684_0071055 3300044712 Bacteria 4403
78 Ga0451576_0111869 3300045051 Bacteria 2842
79 Ga0495638_0000419 3300046460 Bacteria 51336
80 Ga0495650_0000007 3300046471 Bacteria 718072
81 Ga0495606_0030452 3300046507 Bacteria 3770
82 Ga0495610_0000040 3300046512 Bacteria 165165
83 Ga0495616_0105810 3300046513 Bacteria 1313
84 Ga0495643_0112592 3300046522 Bacteria 1382
85 Ga0495648_0009347 3300046524 Bacteria 7611
86 Ga0495654_0000095 3300046530 Bacteria 100179
87 Ga0495625_0000759 3300046660 Bacteria 44970
88 Ga0495625_0000793 3300046660 Bacteria 43797
89 Ga0495625_0003999 3300046660 Bacteria 14118
90 Ga0495625_0011398 3300046660 Bacteria 7255
91 Ga0495613_0036655 3300046689 Bacteria 3637
92 Ga0495589_0002084 3300046794 Bacteria 11314
93 Ga0495672_0007591 3300047320 Bacteria 8140
94 Ga0495681_0080338 3300047470 Bacteria 1457
95 Ga0495686_0006158 3300047472 Bacteria 9275
96 Ga0495686_0011012 3300047472 Bacteria 6397
97 Ga0496101_0171450 3300048904 Bacteria 1668
98 Ga0496105_0236283 3300048908 Bacteria 1484
99 Ga0496106_0006778 3300048909 Bacteria 8480
100 Ga0496107_0000023 3300048910 Bacteria 125918
101 Ga0496121_0001031 3300048924 Bacteria 49668
102 Ga0496124_0250396 3300048927 Bacteria 1311
103 Ga0496126_0022574 3300048929 Bacteria 6118
104 Ga0496126_0030622 3300048929 Bacteria 5095
105 Ga0496126_0415943 3300048929 Bacteria 1088
106 Ga0501034_0000546 3300049571 Bacteria 59719
107 Ga0501036_0256796 3300049572 Bacteria 1464
108 Ga0501043_0012820 3300049579 Bacteria 6552
109 Ga0501047_0002154 3300049581 Bacteria 18833
110 Ga0501067_0041182 3300049583 Bacteria 2565
111 Ga0501238_000385 3300049671 Bacteria 5460
112 Ga0501044_0002249 3300049823 Bacteria 22052
113 Ga0500578_0071213 3300053086 Bacteria 2216
114 Ga0500643_017790 3300053087 Bacteria 2373
115 Ga0500644_0050151 3300053088 Bacteria 1428
116 Ga0500651_0000603 3300053093 Bacteria 17890
117 Ga0500651_0018786 3300053093 Bacteria 4281
118 Ga0500651_0129846 3300053093 Bacteria 1525
119 Ga0500641_0049377 3300053096 Bacteria 1725
120 Ga0500650_0000187 3300053098 Bacteria 14970
121 Ga0500556_0000178 3300053104 Bacteria 52397
122 Ga0500562_019423 3300053108 Bacteria 1757
123 Ga0500595_001821 3300053119 Bacteria 11039
124 Ga0500658_0008527 3300053134 Bacteria 3785
125 Ga0500577_0000021 3300053142 Bacteria 43315
126 Ga0500616_0057518 3300053153 Bacteria 2026
127 Ga0500622_0003937 3300053156 Bacteria 9596
128 Ga0500627_0000811 3300053158 Bacteria 8345
129 Ga0500636_0000619 3300053177 Bacteria 19207
130 Ga0500645_000875 3300053730 Bacteria 17533
131 Ga0500645_015393 3300053730 Bacteria 2423
132 Ga0530510_0049086 3300061734 Bacteria 3050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0030452 Ga0495606_0030452_14_853 276
2 3300009101 Ga0105247_10003643 Ga0105247_100036432 285
3 iso_pu_bacteria 2858688981 2858692261 291
4 3300048929 Ga0496126_0415943 Ga0496126_0415943_107_1012 300
5 iso_pu_bacteria 2908756301 2908761799 300
6 3300031727 Ga0316576_10222645 Ga0316576_102226451 306
7 3300031691 Ga0316579_10079249 Ga0316579_100792491 307
8 3300031728 Ga0316578_10052161 Ga0316578_100521614 307
9 3300036712 Ga0316584_0080539 Ga0316584_0080539_200_1123 307
10 3300037588 Ga0316581_0053162 Ga0316581_0053162_198_1208 311
11 3300033528 Ga0316588_1021603 Ga0316588_10216031 314
12 3300035398 Ga0316574_0001009 Ga0316574_0001009_7229_8197 316
13 3300036647 Ga0316582_0160172 Ga0316582_0160172_54_1022 316
14 3300049671 Ga0501238_000385 Ga0501238_000385_4124_5107 317
15 3300046660 Ga0495625_0011398 Ga0495625_0011398_2462_3472 318
16 3300031665 Ga0316575_10016836 Ga0316575_100168362 320
17 3300033541 Ga0316596_1028420 Ga0316596_10284201 321
18 3300036647 Ga0316582_0009577 Ga0316582_0009577_267_1262 321
19 3300053108 Ga0500562_019423 Ga0500562_019423_293_1294 323
20 iso_pu_bacteria 2517572143 2517895073 323
21 iso_pu_bacteria 2903748898 2903758344 323
22 3300053177 Ga0500636_0000619 Ga0500636_0000619_1741_2724 324
23 3300031733 Ga0316577_10040151 Ga0316577_100401512 326
24 3300042876 Ga0451577_0092933 Ga0451577_0092933_556_1593 326
25 3300044712 Ga0453684_0071055 Ga0453684_0071055_2517_3554 326
26 3300045051 Ga0451576_0111869 Ga0451576_0111869_280_1317 326
27 3300049572 Ga0501036_0256796 Ga0501036_0256796_141_1133 326
28 3300049579 Ga0501043_0012820 Ga0501043_0012820_5070_6062 326
29 3300049581 Ga0501047_0002154 Ga0501047_0002154_14126_15118 326
30 3300049823 Ga0501044_0002249 Ga0501044_0002249_15357_16349 326
31 3300053096 Ga0500641_0049377 Ga0500641_0049377_236_1219 326
32 3300053098 Ga0500650_0000187 Ga0500650_0000187_9845_10828 326
33 iso_pu_bacteria 2513237096 2513658669 326
34 iso_pu_bacteria 2513237145 2513920767 326
35 3300005344 Ga0070661_100102197 Ga0070661_1001021972 327
36 3300013105 Ga0157369_10002444 Ga0157369_1000244415 327
37 3300013297 Ga0157378_10378243 Ga0157378_103782432 327
38 3300025900 Ga0207710_10072285 Ga0207710_100722853 327
39 3300025920 Ga0207649_10071943 Ga0207649_100719432 327
40 3300031665 Ga0316575_10000886 Ga0316575_100008862 328
41 3300048927 Ga0496124_0250396 Ga0496124_0250396_298_1287 328
42 3300048929 Ga0496126_0030622 Ga0496126_0030622_201_1190 328
43 3300031456 Ga0307513_10094960 Ga0307513_100949601 329
44 3300047472 Ga0495686_0011012 Ga0495686_0011012_1925_2917 329
45 3300053093 Ga0500651_0129846 Ga0500651_0129846_87_1079 329
46 3300053119 Ga0500595_001821 Ga0500595_001821_2520_3512 329
47 iso_pu_bacteria 2881927736 2881930196 329
48 3300033442 Ga0315911_1000007 Ga0315911_1000007254 330
49 3300005331 Ga0070670_100000035 Ga0070670_100000035145 331
50 3300005347 Ga0070668_100003075 Ga0070668_1000030756 331
51 3300005353 Ga0070669_100110884 Ga0070669_1001108844 331
52 3300005367 Ga0070667_100001410 Ga0070667_1000014106 331
53 3300005548 Ga0070665_100016403 Ga0070665_1000164034 331
54 3300005617 Ga0068859_100117744 Ga0068859_1001177441 331
55 3300005618 Ga0068864_100001144 Ga0068864_10000114411 331
56 3300005841 Ga0068863_100002037 Ga0068863_10000203719 331
57 3300005844 Ga0068862_100000368 Ga0068862_10000036840 331
58 3300005981 Ga0081538_10021746 Ga0081538_100217464 331
59 3300006931 Ga0097620_100117745 Ga0097620_1001177451 331
60 3300009101 Ga0105247_10076177 Ga0105247_100761772 331
61 3300009177 Ga0105248_10007747 Ga0105248_1000774714 331
62 3300009553 Ga0105249_10000525 Ga0105249_1000052538 331
63 3300013306 Ga0163162_10075328 Ga0163162_100753284 331
64 3300014968 Ga0157379_10003228 Ga0157379_1000322811 331
65 3300025925 Ga0207650_10000350 Ga0207650_1000035023 331
66 3300025941 Ga0207711_10015908 Ga0207711_100159085 331
67 3300025961 Ga0207712_10002507 Ga0207712_100025075 331
68 3300025972 Ga0207668_10000035 Ga0207668_10000035106 331
69 3300025986 Ga0207658_10000300 Ga0207658_1000030020 331
70 3300026088 Ga0207641_10006570 Ga0207641_1000657013 331
71 3300026095 Ga0207676_10000970 Ga0207676_1000097019 331
72 3300028379 Ga0268266_10004822 Ga0268266_100048227 331
73 3300028380 Ga0268265_10010277 Ga0268265_100102774 331
74 3300048904 Ga0496101_0171450 Ga0496101_0171450_655_1656 331
75 3300053088 Ga0500644_0050151 Ga0500644_0050151_355_1368 331
76 3300053093 Ga0500651_0018786 Ga0500651_0018786_28_1041 331
77 iso_pu_bacteria 2791355199 2793076779 331
78 iso_pu_bacteria 2908739725 2908745309 331
79 3300031727 Ga0316576_10000302 Ga0316576_100003023 332
80 3300046460 Ga0495638_0000419 Ga0495638_0000419_25928_26932 332
81 3300046512 Ga0495610_0000040 Ga0495610_0000040_133159_134163 332
82 3300046513 Ga0495616_0105810 Ga0495616_0105810_213_1217 332
83 3300046522 Ga0495643_0112592 Ga0495643_0112592_158_1162 332
84 3300046660 Ga0495625_0000793 Ga0495625_0000793_19270_20274 332
85 3300053087 Ga0500643_017790 Ga0500643_017790_592_1602 332
86 3300053134 Ga0500658_0008527 Ga0500658_0008527_1736_2740 332
87 3300053156 Ga0500622_0003937 Ga0500622_0003937_6559_7569 332
88 3300005327 Ga0070658_10139385 Ga0070658_101393853 333
89 3300005564 Ga0070664_100088333 Ga0070664_1000883334 333
90 3300005614 Ga0068856_100177082 Ga0068856_1001770823 333
91 3300009545 Ga0105237_10165888 Ga0105237_101658882 333
92 3300025299 Ga0209256_1000641 Ga0209256_100064130 333
93 3300025920 Ga0207649_10100014 Ga0207649_101000142 333
94 3300025944 Ga0207661_10185865 Ga0207661_101858654 333
95 3300026078 Ga0207702_10214179 Ga0207702_102141792 333
96 3300047320 Ga0495672_0007591 Ga0495672_0007591_441_1448 333
97 3300047472 Ga0495686_0006158 Ga0495686_0006158_6467_7474 333
98 3300053730 Ga0500645_015393 Ga0500645_015393_884_1891 333
99 iso_pu_bacteria 8006933436 8006942665 333
100 iso_pu_bacteria 8006973647 8006982394 333
101 3300034818 Ga0373950_0008422 Ga0373950_0008422_328_1359 334
102 3300046471 Ga0495650_0000007 Ga0495650_0000007_95184_96194 334
103 3300046524 Ga0495648_0009347 Ga0495648_0009347_1240_2250 334
104 3300046530 Ga0495654_0000095 Ga0495654_0000095_67938_68948 334
105 3300046660 Ga0495625_0000759 Ga0495625_0000759_26501_27517 334
106 3300046660 Ga0495625_0003999 Ga0495625_0003999_6674_7684 334
107 3300046794 Ga0495589_0002084 Ga0495589_0002084_5577_6581 334
108 3300047470 Ga0495681_0080338 Ga0495681_0080338_414_1424 334
109 3300048909 Ga0496106_0006778 Ga0496106_0006778_4388_5410 334
110 3300048910 Ga0496107_0000023 Ga0496107_0000023_5731_6753 334
111 3300048924 Ga0496121_0001031 Ga0496121_0001031_18908_19930 334
112 3300048929 Ga0496126_0022574 Ga0496126_0022574_3194_4213 334
113 3300053104 Ga0500556_0000178 Ga0500556_0000178_31420_32430 334
114 3300053142 Ga0500577_0000021 Ga0500577_0000021_7823_8830 334
115 3300053153 Ga0500616_0057518 Ga0500616_0057518_792_1802 334
116 3300053158 Ga0500627_0000811 Ga0500627_0000811_2120_3130 334
117 3300053730 Ga0500645_000875 Ga0500645_000875_5055_6065 334
118 3300005937 Ga0081455_10033612 Ga0081455_100336122 335
119 3300005983 Ga0081540_1024072 Ga0081540_10240723 335
120 3300005983 Ga0081540_1031192 Ga0081540_10311923 335
121 3300049571 Ga0501034_0000546 Ga0501034_0000546_32024_33151 335
122 3300049583 Ga0501067_0041182 Ga0501067_0041182_1194_2219 335
123 3300053086 Ga0500578_0071213 Ga0500578_0071213_1091_2113 335
124 3300061734 Ga0530510_0049086 Ga0530510_0049086_1579_2589 335
125 iso_pu_bacteria 2739367655 2739612581 335
126 3300005545 Ga0070695_100008563 Ga0070695_1000085636 337
127 3300053093 Ga0500651_0000603 Ga0500651_0000603_2240_3256 337
128 iso_pu_bacteria 8019555841 8019562580 337
129 iso_pu_bacteria 8019565922 8019572655 337
130 3300006237 Ga0097621_100246272 Ga0097621_1002462722 338
131 3300025929 Ga0207664_10016924 Ga0207664_100169243 338
132 3300031665 Ga0316575_10026970 Ga0316575_100269702 338
133 3300031727 Ga0316576_10109461 Ga0316576_101094612 338
134 3300031728 Ga0316578_10072549 Ga0316578_100725493 338
135 3300031733 Ga0316577_10005716 Ga0316577_100057162 338
136 3300035088 Ga0373940_0039198 Ga0373940_0039198_14_1048 338
137 3300035691 Ga0373931_0032794 Ga0373931_0032794_1207_2241 338
138 3300036647 Ga0316582_0123117 Ga0316582_0123117_182_1198 338
139 3300048908 Ga0496105_0236283 Ga0496105_0236283_419_1453 338
140 iso_pu_bacteria 2513237150 2513956782 338
141 iso_pu_bacteria 2513237165 2514045366 338
142 iso_pu_bacteria 2906635258 2906639725 338
143 iso_pu_bacteria 2906660503 2906660530 338
144 iso_pu_bacteria 644736347 644747832 338
145 3300005341 Ga0070691_10011107 Ga0070691_100111075 340
146 3300005441 Ga0070700_100012140 Ga0070700_1000121401 340
147 3300005444 Ga0070694_100085716 Ga0070694_1000857163 340
148 3300005983 Ga0081540_1010012 Ga0081540_10100122 340
149 3300046689 Ga0495613_0036655 Ga0495613_0036655_430_1494 340
150 iso_pu_bacteria 2901300506 2901312116 340
151 3300031665 Ga0316575_10012338 Ga0316575_100123384 343
152 3300001991 JGI24743J22301_10017459 JGI24743J22301_100174591 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12710

HAD

haloacid dehalogenase-like hydrolase

94

299

0.72

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

91

300

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.9301 40 344
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.9272 40 344
3fvv-assembly1.cif.gz_A the crystal structure of the protein with unknown function from bordetella pertussis tohama i 0.6812 75 333
3fvv-assembly1.cif.gz_A the crystal structure of the protein with unknown function from bordetella pertussis tohama i 0.6705 75 333
4as3-assembly2.cif.gz_D pseudomonas aeruginosa phosphorylcholine phosphatase. orthorhombic form 0.6083 43 331
ID Description Score Start End Superfamily
4gxtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6948 51 332 3.40.50.1000
3fvvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6929 182 332 3.40.50.1000
1y8aA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6871 191 296 3.40.50.1000
4as3C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6464 43 335 3.40.50.1000
3kd3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.639 177 310 3.40.50.1000
ID Description Score Start End GO Terms
AF-X0WTZ3-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9843 170 344
AF-A0A0E3VXD4-F1-model_v4 Nonspecific acid phosphatase 0.9839 149 341
AF-A0A355GK92-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9836 173 344 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A0U2YIC5-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9817 143 342 GO:0016787
AF-A0A7Y0RQX9-F1-model_v4 deleted 0.9816 85 344

Feature Viewer

pLDDT pTM Quality
86.86 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map