F212664

General Info

Members Datasets Scaffolds Average Seq Length
151 110 302 209

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0254061|Ga0496124_0254061_504_1196
Length 230
Sequence LSEGMTTSFLFDGPEDARFTLLLVHGAGAPMDSASMNAATKALADQGIRVARFEFGYMAARRTGDGRKPPPKAEKVMPEYIEAIEDLGPTRGPLFIGGKSMGGRVASMVADPLFVAGRIAGLLCLGYPFHPPAKPEQLRTAHLEGLSAPALICQGTRDEFGTREEVSGYTLSPSIELLWLEDGDHDLKPRKSISAFSTADHLRTLAEATRGWMESVAAEARAGYIHGANG

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
16 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
17 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
18 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
19 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
27 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
28 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
29 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
30 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
31 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
32 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
33 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
34 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
35 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
36 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
37 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
38 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
39 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
40 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
41 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
42 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
43 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
44 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
45 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
46 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
47 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
48 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
49 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
59 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
60 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
61 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
62 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
65 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
67 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
68 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
69 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
70 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
71 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
72 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
73 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
74 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
75 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
76 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
77 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
78 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
79 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
80 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
81 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
82 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
83 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
84 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
85 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
86 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
87 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
88 2643221591 Devosia sp. Root685 Isolate Unclassified
89 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
90 2643221651 Afipia sp. Root123D2 Isolate Unclassified
91 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
92 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
93 2841760612 Bosea sp. Tri-49 Isolate Nodule
94 2844104063 Bosea sp. Tri-39 Isolate Nodule
95 2851182111 Bosea sp. Tri-44 Isolate Nodule
96 2851246043 Bosea sp. Tri-54 Isolate Nodule
97 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
98 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
99 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
100 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
101 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
102 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
103 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
104 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
105 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
106 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
107 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
108 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
109 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
110 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.46
Metatranscriptomes 0
Isolates 18.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.13
Nodule 11.26
Rhizoplane 2.65
Rhizosphere 35.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0254061 3300048927 Bacteria 1298
2 JGI25158J39367_1000379 3300002739 Bacteria 9445
3 JGI25152J39213_1013750 3300002773 Bacteria 1670
4 JGI25151J46595_10000036 3300003187 Bacteria 188770
5 JGI25151J46595_10000225 3300003187 Bacteria 66974
6 JGI25151J46595_10045516 3300003187 Bacteria 1548
7 JGI25160J50197_1004349 3300003354 Bacteria 6140
8 JGI25160J50197_1004526 3300003354 Bacteria 5996
9 Ga0055530_10055794 3300003791 Bacteria 898
10 Ga0055531_10057859 3300003794 Bacteria 968
11 Ga0065165_1000062 3300005262 Bacteria 178885
12 Ga0065165_1014904 3300005262 Bacteria 2994
13 Ga0070667_101043202 3300005367 Bacteria 763
14 Ga0068863_101186970 3300005841 Bacteria 769
15 Ga0075362_10005704 3300006177 Bacteria 4581
16 Ga0075367_10012714 3300006178 Bacteria 4501
17 Ga0075366_10266615 3300006195 Bacteria 1046
18 Ga0079104_1037506 3300006946 Bacteria 1154
19 Ga0214544_1000329 3300021320 Bacteria 82143
20 Ga0214542_1000084 3300021321 Bacteria 120499
21 Ga0214543_1000076 3300021327 Bacteria 120483
22 Ga0209130_1000403 3300025284 Bacteria 47298
23 Ga0209130_1000564 3300025284 Bacteria 36607
24 Ga0209025_1000017 3300025294 Bacteria 768983
25 Ga0209025_1000224 3300025294 Bacteria 133328
26 Ga0209025_1000320 3300025294 Bacteria 106773
27 Ga0209025_1001224 3300025294 Bacteria 35854
28 Ga0209025_1032431 3300025294 Bacteria 2442
29 Ga0209025_1104659 3300025294 Bacteria 885
30 Ga0209758_1006905 3300025297 Bacteria 7928
31 Ga0209758_1027500 3300025297 Bacteria 2428
32 Ga0209050_1012391 3300025298 Bacteria 3917
33 Ga0207426_1000022 3300025302 Bacteria 547377
34 Ga0207426_1000151 3300025302 Bacteria 185103
35 Ga0207426_1013038 3300025302 Bacteria 3099
36 Ga0209257_1000923 3300025304 Bacteria 40837
37 Ga0207650_10046748 3300025925 Bacteria 3188
38 Ga0207706_10342268 3300025933 Bacteria 1301
39 Ga0209281_1000446 3300027111 Bacteria 59196
40 Ga0307513_10006119 3300031456 Bacteria 15799
41 Ga0307508_10024349 3300031616 Bacteria 5494
42 Ga0307405_10560851 3300031731 Bacteria 926
43 Ga0307406_10148340 3300031901 Bacteria 1670
44 Ga0307510_10097270 3300033180 Bacteria 2755
45 Ga0439465_0016685 3300041413 Bacteria 2291
46 Ga0451797_1559641 3300041453 Bacteria 770
47 Ga0439431_0056273 3300041997 Bacteria 1028
48 Ga0495585_0015355 3300046492 Bacteria 4450
49 Ga0495610_0001955 3300046512 Bacteria 17730
50 Ga0495643_0062768 3300046522 Bacteria 1966
51 Ga0495623_0035114 3300046679 Bacteria 3213
52 Ga0495672_0183969 3300047320 Bacteria 1056
53 Ga0495686_0297338 3300047472 Bacteria 892
54 Ga0496106_0000287 3300048909 Bacteria 35691
55 Ga0496111_0002238 3300048914 Bacteria 11617
56 Ga0496117_0005140 3300048920 Bacteria 13968
57 Ga0496117_0359388 3300048920 Bacteria 749
58 Ga0496119_0137054 3300048922 Bacteria 1326
59 Ga0496122_0000651 3300048925 Bacteria 70375
60 Ga0496122_0001019 3300048925 Bacteria 49576
61 Ga0496122_0046170 3300048925 Bacteria 3376
62 Ga0496123_0000043 3300048926 Bacteria 253752
63 Ga0496123_0012750 3300048926 Bacteria 7128
64 Ga0496124_0004204 3300048927 Bacteria 16952
65 Ga0496124_0023965 3300048927 Bacteria 5557
66 Ga0496125_0000276 3300048928 Bacteria 103024
67 Ga0496125_0000671 3300048928 Bacteria 57108
68 Ga0496126_0002292 3300048929 Bacteria 26384
69 Ga0496126_0052816 3300048929 Bacteria 3691
70 Ga0496126_0072807 3300048929 Bacteria 3056
71 Ga0496126_0729042 3300048929 Bacteria 767
72 Ga0501032_0141609 3300049569 Bacteria 1583
73 Ga0501033_0057438 3300049570 Bacteria 2876
74 Ga0501033_0123499 3300049570 Bacteria 1877
75 Ga0501034_0090048 3300049571 Bacteria 3066
76 Ga0501034_0383227 3300049571 Bacteria 1331
77 Ga0501034_0909526 3300049571 Bacteria 767
78 Ga0501036_0028225 3300049572 Bacteria 4744
79 Ga0501036_0782459 3300049572 Bacteria 786
80 Ga0501037_0466538 3300049573 Bacteria 860
81 Ga0501038_0057411 3300049574 Bacteria 3342
82 Ga0501038_0203266 3300049574 Bacteria 1589
83 Ga0501038_0285727 3300049574 Bacteria 1297
84 Ga0501039_0119342 3300049575 Bacteria 2066
85 Ga0501039_0150010 3300049575 Bacteria 1832
86 Ga0501046_0463307 3300049580 Bacteria 910
87 Ga0501047_0611820 3300049581 Bacteria 910
88 Ga0501047_0979976 3300049581 Bacteria 659
89 Ga0501068_0076371 3300049584 Bacteria 2050
90 Ga0501070_0076371 3300049586 Bacteria 2773
91 Ga0501073_0033872 3300049589 Bacteria 3636
92 Ga0501073_0184649 3300049589 Bacteria 1443
93 Ga0501074_0069709 3300049590 Bacteria 2528
94 Ga0501079_0715914 3300049741 Bacteria 788
95 Ga0501080_0187522 3300049742 Bacteria 1901
96 Ga0501080_0504669 3300049742 Bacteria 1081
97 Ga0501083_0067592 3300049744 Bacteria 2379
98 Ga0501083_0679085 3300049744 Bacteria 670
99 Ga0501035_0172435 3300049822 Bacteria 1868
100 Ga0501035_0173381 3300049822 Bacteria 1862
101 Ga0501035_0345987 3300049822 Bacteria 1245
102 Ga0501044_0080135 3300049823 Bacteria 3307
103 Ga0501044_0360283 3300049823 Bacteria 1372
104 Ga0501044_0690567 3300049823 Bacteria 907
105 nmdc:mga03683_9872_c1 3300050489 Bacteria 3409
106 nmdc:mga00v17_299114_c1 3300050491 Bacteria 1045
107 nmdc:mga0yw44_104508_c1 3300050492 Bacteria 1808
108 nmdc:mga0k408_74529_c1 3300050493 Bacteria 1983
109 nmdc:mga06z11_148060_c1 3300050494 Bacteria 1332
110 nmdc:mga06z11_234689_c1 3300050494 Bacteria 1076
111 nmdc:mga07m45_240506_c1 3300050496 Bacteria 1053
112 nmdc:mga0sz30_63616_c1 3300050516 Bacteria 1579
113 Ga0500644_0185192 3300053088 Bacteria 854
114 Ga0500618_000133 3300053125 Bacteria 62246
115 Ga0500568_0000097 3300053139 Bacteria 82019
116 Ga0500568_0028943 3300053139 Bacteria 2305
117 Ga0500604_0026503 3300053151 Bacteria 1672
118 Ga0500604_0185325 3300053151 Bacteria 714
119 Ga0500616_0001201 3300053153 Bacteria 26311
120 Ga0500622_0019598 3300053156 Bacteria 3592
121 Ga0500636_0062139 3300053177 Bacteria 2178
122 Ga0500609_004742 3300053731 Bacteria 1872
123 Ga0501084_0675650 3300054114 Bacteria 871
124 2551727180 2551306091 Bacteria 7086830
125 2551733970 2551306092 Bacteria 6992595
126 2551744825 2551306093 Bacteria 7064773
127 2585255742 2582581304 Bacteria 5831370
128 2599718069 2599185236 Bacteria 6875203
129 2643963878 2643221591 Bacteria 4397626
130 2644241996 2643221643 Bacteria 5749658
131 2644289558 2643221651 Bacteria 4798932
132 2821450940 2821443989 Bacteria 7658172
133 2839994539 2839993093 Bacteria 5512535
134 2841765116 2841760612 Bacteria 6454112
135 2844106726 2844104063 Bacteria 6440972
136 2851185874 2851182111 Bacteria 6047226
137 2851248766 2851246043 Bacteria 6439203
138 2891377344 2891373044 Bacteria 5202277
139 2920764289 2920760137 Bacteria 7427611
140 2937016764 2937016420 Bacteria 6782579
141 2937845350 2937843397 Bacteria 5256375
142 2939671417 2939669807 Bacteria 5028511
143 2957455035 2957450854 Bacteria 6765715
144 2964677796 2964670856 Bacteria 6851364
145 2989353384 2989349275 Bacteria 6349068
146 2989774432 2989771324 Bacteria 5605128
147 3002144286 3002141150 Bacteria 5254435
148 3003933127 3003930520 Bacteria 5667563
149 3005413526 3005409236 Bacteria 7188837
150 8002285959 8002285264 Bacteria 6717907
151 8057532686 8057529695 Bacteria 6306553
152 Ga0496124_0254061
153 JGI25158J39367_1000379
154 JGI25152J39213_1013750
155 JGI25151J46595_10000036
156 JGI25151J46595_10000225
157 JGI25151J46595_10045516
158 JGI25160J50197_1004349
159 JGI25160J50197_1004526
160 Ga0055530_10055794
161 Ga0055531_10057859
162 Ga0065165_1000062
163 Ga0065165_1014904
164 Ga0070667_101043202
165 Ga0068863_101186970
166 Ga0075362_10005704
167 Ga0075367_10012714
168 Ga0075366_10266615
169 Ga0079104_1037506
170 Ga0214544_1000329
171 Ga0214542_1000084
172 Ga0214543_1000076
173 Ga0209130_1000403
174 Ga0209130_1000564
175 Ga0209025_1000017
176 Ga0209025_1000224
177 Ga0209025_1000320
178 Ga0209025_1001224
179 Ga0209025_1032431
180 Ga0209025_1104659
181 Ga0209758_1006905
182 Ga0209758_1027500
183 Ga0209050_1012391
184 Ga0207426_1000022
185 Ga0207426_1000151
186 Ga0207426_1013038
187 Ga0209257_1000923
188 Ga0207650_10046748
189 Ga0207706_10342268
190 Ga0209281_1000446
191 Ga0307513_10006119
192 Ga0307508_10024349
193 Ga0307405_10560851
194 Ga0307406_10148340
195 Ga0307510_10097270
196 Ga0439465_0016685
197 Ga0451797_1559641
198 Ga0439431_0056273
199 Ga0495585_0015355
200 Ga0495610_0001955
201 Ga0495643_0062768
202 Ga0495623_0035114
203 Ga0495672_0183969
204 Ga0495686_0297338
205 Ga0496106_0000287
206 Ga0496111_0002238
207 Ga0496117_0005140
208 Ga0496117_0359388
209 Ga0496119_0137054
210 Ga0496122_0000651
211 Ga0496122_0001019
212 Ga0496122_0046170
213 Ga0496123_0000043
214 Ga0496123_0012750
215 Ga0496124_0004204
216 Ga0496124_0023965
217 Ga0496125_0000276
218 Ga0496125_0000671
219 Ga0496126_0002292
220 Ga0496126_0052816
221 Ga0496126_0072807
222 Ga0496126_0729042
223 Ga0501032_0141609
224 Ga0501033_0057438
225 Ga0501033_0123499
226 Ga0501034_0090048
227 Ga0501034_0383227
228 Ga0501034_0909526
229 Ga0501036_0028225
230 Ga0501036_0782459
231 Ga0501037_0466538
232 Ga0501038_0057411
233 Ga0501038_0203266
234 Ga0501038_0285727
235 Ga0501039_0119342
236 Ga0501039_0150010
237 Ga0501046_0463307
238 Ga0501047_0611820
239 Ga0501047_0979976
240 Ga0501068_0076371
241 Ga0501070_0076371
242 Ga0501073_0033872
243 Ga0501073_0184649
244 Ga0501074_0069709
245 Ga0501079_0715914
246 Ga0501080_0187522
247 Ga0501080_0504669
248 Ga0501083_0067592
249 Ga0501083_0679085
250 Ga0501035_0172435
251 Ga0501035_0173381
252 Ga0501035_0345987
253 Ga0501044_0080135
254 Ga0501044_0360283
255 Ga0501044_0690567
256 nmdc:mga03683_9872_c1
257 nmdc:mga00v17_299114_c1
258 nmdc:mga0yw44_104508_c1
259 nmdc:mga0k408_74529_c1
260 nmdc:mga06z11_148060_c1
261 nmdc:mga06z11_234689_c1
262 nmdc:mga07m45_240506_c1
263 nmdc:mga0sz30_63616_c1
264 Ga0500644_0185192
265 Ga0500618_000133
266 Ga0500568_0000097
267 Ga0500568_0028943
268 Ga0500604_0026503
269 Ga0500604_0185325
270 Ga0500616_0001201
271 Ga0500622_0019598
272 Ga0500636_0062139
273 Ga0500609_004742
274 Ga0501084_0675650
275 2551727180
276 2551733970
277 2551744825
278 2585255742
279 2599718069
280 2643963878
281 2644241996
282 2644289558
283 2821450940
284 2839994539
285 2841765116
286 2844106726
287 2851185874
288 2851248766
289 2891377344
290 2920764289
291 2937016764
292 2937845350
293 2939671417
294 2957455035
295 2964677796
296 2989353384
297 2989774432
298 3002144286
299 3003933127
300 3005413526
301 8002285959
302 8057532686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

17

214

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kst-assembly1.cif.gz_C stationary phase survival protein e (sure) from xylella fastidiosa- xfsure-tsamp (tetramer smaller - crystallization with 3'amp). 0.8416 15 49
5kst-assembly1.cif.gz_D stationary phase survival protein e (sure) from xylella fastidiosa- xfsure-tsamp (tetramer smaller - crystallization with 3'amp). 0.8415 15 49
5kst-assembly1.cif.gz_B stationary phase survival protein e (sure) from xylella fastidiosa- xfsure-tsamp (tetramer smaller - crystallization with 3'amp). 0.8379 15 49
7r0x-assembly1.cif.gz_A structure of the branching thioesterase from oocydin biosynthesis 0.7524 15 125
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.75 4 208
ID Description Score Start End Superfamily
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8147 4 204 3.40.50.1820
af_Q0JC68_360_563_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8119 86 120 3.40.50.1820
af_B4FGW5_14_203_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8079 10 189 3.40.50.1820
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8076 1 195 3.40.50.1820
af_I1K6A2_1_89_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8047 113 185 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1T5HB56-F1-model_v4 Alpha/beta hydrolase family protein 0.9964 97 208 GO:0016787
AF-A0A7W5Q984-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9956 26 209
AF-A0A7I0J689-F1-model_v4 Alpha/beta hydrolase 0.9952 86 198 GO:0016787
AF-A0A6P0AGJ1-F1-model_v4 deleted 0.9937 4 209
AF-A0A2S4MKH7-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9906 2 208

Map