F212135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 151 | 103 | 302 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0102161|Ga0373927_0102161_932_1621 |
| Length | 229 |
| Sequence | VTAEGFAMLFVCVDPDFSVASMADAASISHRTYFRRARCQDRQAKLLSDQHLTNLLRFAQASRYPARNRLIVLLSFKAGLRAAEIANLTWAMVVDATGAIAPVIELHDQAAKNRGGRRIPVHPDLYIALSRWRDLSPSTGLMITSERGDAMRPRSIVNWFAYAYRRIGLEGCSSHSGRRTFITRAARLVHKTGGSLRDVQLLAGHRSIQTTQRYIDGDTEAQRKLVSLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 13 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 17 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 18 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 25 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 26 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 42 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 43 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 44 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 45 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 46 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 47 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 48 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 49 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 50 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 51 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 52 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 53 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 54 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 55 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 56 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 57 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 58 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 59 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 60 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 61 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 85 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 86 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 87 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 88 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 89 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 90 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 92 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 93 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 94 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 95 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 96 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 97 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 98 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 102 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 103 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.32 |
| Nodule | 0.66 |
| Rhizoplane | 11.92 |
| Rhizosphere | 82.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373927_0102161 | 3300035695 | Bacteria | 1865 |
| 2 | Ga0070683_100303706 | 3300005329 | Bacteria | 1518 |
| 3 | Ga0070667_100877676 | 3300005367 | Bacteria | 834 |
| 4 | Ga0070709_10149754 | 3300005434 | Bacteria | 1611 |
| 5 | Ga0070713_101037026 | 3300005436 | Unclassified | 792 |
| 6 | Ga0070710_10001345 | 3300005437 | Bacteria | 11609 |
| 7 | Ga0070710_10007825 | 3300005437 | Bacteria | 5186 |
| 8 | Ga0070710_10089728 | 3300005437 | Bacteria | 1811 |
| 9 | Ga0070711_100015665 | 3300005439 | Unclassified | 4799 |
| 10 | Ga0070708_100919867 | 3300005445 | Bacteria | 821 |
| 11 | Ga0070706_100027600 | 3300005467 | Bacteria | 5224 |
| 12 | Ga0070698_100117454 | 3300005471 | Bacteria | 2622 |
| 13 | Ga0070684_100783594 | 3300005535 | Bacteria | 891 |
| 14 | Ga0068855_100078984 | 3300005563 | Bacteria | 3817 |
| 15 | Ga0068855_100346467 | 3300005563 | Bacteria | 1637 |
| 16 | Ga0070717_10144023 | 3300006028 | Bacteria | 2057 |
| 17 | Ga0070717_10180939 | 3300006028 | Unclassified | 1837 |
| 18 | Ga0070717_10245710 | 3300006028 | Unclassified | 1580 |
| 19 | Ga0070716_100023098 | 3300006173 | Bacteria | 3294 |
| 20 | Ga0070712_100030756 | 3300006175 | Bacteria | 3613 |
| 21 | Ga0070712_100602955 | 3300006175 | Unclassified | 930 |
| 22 | Ga0070712_100793790 | 3300006175 | Unclassified | 812 |
| 23 | Ga0099794_10337725 | 3300007265 | Unclassified | 783 |
| 24 | Ga0099795_10348013 | 3300007788 | Unclassified | 662 |
| 25 | Ga0105240_10033028 | 3300009093 | Bacteria | 6690 |
| 26 | Ga0105241_10162149 | 3300009174 | Bacteria | 1839 |
| 27 | Ga0105238_10940339 | 3300009551 | Bacteria | 884 |
| 28 | Ga0157370_10048155 | 3300013104 | Unclassified | 4084 |
| 29 | Ga0157372_10027260 | 3300013307 | Bacteria | 6220 |
| 30 | Ga0157372_10581747 | 3300013307 | Bacteria | 1305 |
| 31 | Ga0163163_10242425 | 3300014325 | Bacteria | 1852 |
| 32 | Ga0224572_1033849 | 3300024225 | Unclassified | 971 |
| 33 | Ga0228598_1006623 | 3300024227 | Bacteria | 2392 |
| 34 | Ga0228598_1034373 | 3300024227 | Bacteria | 999 |
| 35 | Ga0207692_10335750 | 3300025898 | Bacteria | 928 |
| 36 | Ga0207688_10686861 | 3300025901 | Bacteria | 647 |
| 37 | Ga0207699_10005190 | 3300025906 | Bacteria | 6230 |
| 38 | Ga0207684_10050814 | 3300025910 | Bacteria | 3518 |
| 39 | Ga0207695_10135163 | 3300025913 | Unclassified | 2419 |
| 40 | Ga0207671_10575405 | 3300025914 | Unclassified | 898 |
| 41 | Ga0207693_10000773 | 3300025915 | Bacteria | 28744 |
| 42 | Ga0207693_10014918 | 3300025915 | Bacteria | 6240 |
| 43 | Ga0207693_10026448 | 3300025915 | Unclassified | 4593 |
| 44 | Ga0207693_10514891 | 3300025915 | Unclassified | 934 |
| 45 | Ga0207663_10003298 | 3300025916 | Bacteria | 7868 |
| 46 | Ga0207659_10712993 | 3300025926 | Bacteria | 859 |
| 47 | Ga0207700_10522616 | 3300025928 | Bacteria | 1052 |
| 48 | Ga0207664_10083845 | 3300025929 | Bacteria | 2598 |
| 49 | Ga0207665_10066557 | 3300025939 | Unclassified | 2452 |
| 50 | Ga0207665_10852548 | 3300025939 | Unclassified | 721 |
| 51 | Ga0207661_10409014 | 3300025944 | Bacteria | 1231 |
| 52 | Ga0207667_10080135 | 3300025949 | Bacteria | 3383 |
| 53 | Ga0207676_11407417 | 3300026095 | Bacteria | 693 |
| 54 | Ga0265338_10018689 | 3300028800 | Bacteria | 7407 |
| 55 | Ga0265338_10044503 | 3300028800 | Bacteria | 4097 |
| 56 | Ga0265330_10012385 | 3300031235 | Bacteria | 3989 |
| 57 | Ga0265325_10009003 | 3300031241 | Bacteria | 5860 |
| 58 | Ga0265325_10014170 | 3300031241 | Unclassified | 4514 |
| 59 | Ga0265339_10023060 | 3300031249 | Bacteria | 3601 |
| 60 | Ga0307513_10248347 | 3300031456 | Bacteria | 1578 |
| 61 | Ga0265313_10003668 | 3300031595 | Bacteria | 12277 |
| 62 | Ga0265313_10160046 | 3300031595 | Unclassified | 957 |
| 63 | Ga0373943_0029736 | 3300035170 | Unclassified | 2582 |
| 64 | Ga0373946_0101415 | 3300035171 | Bacteria | 1291 |
| 65 | Ga0373955_0154664 | 3300035172 | Bacteria | 1351 |
| 66 | Ga0373955_0331039 | 3300035172 | Unclassified | 921 |
| 67 | Ga0373935_0022492 | 3300035692 | Bacteria | 3867 |
| 68 | Ga0373935_0171867 | 3300035692 | Bacteria | 1483 |
| 69 | Ga0373935_0448509 | 3300035692 | Bacteria | 932 |
| 70 | Ga0373935_0559367 | 3300035692 | Bacteria | 834 |
| 71 | Ga0373927_0055202 | 3300035695 | Bacteria | 2569 |
| 72 | Ga0373947_0002184 | 3300035725 | Bacteria | 11875 |
| 73 | Ga0373947_0501184 | 3300035725 | Unclassified | 825 |
| 74 | Ga0373937_0049499 | 3300036401 | Bacteria | 3848 |
| 75 | Ga0373937_0232852 | 3300036401 | Unclassified | 1735 |
| 76 | Ga0373925_0023827 | 3300037068 | Bacteria | 4465 |
| 77 | Ga0436364_1088620 | 3300037853 | Bacteria | 6418 |
| 78 | Ga0436364_1309948 | 3300037853 | Bacteria | 707 |
| 79 | Ga0395901_0082698 | 3300038443 | Bacteria | 3355 |
| 80 | Ga0436365_0984862 | 3300039437 | Bacteria | 1025 |
| 81 | Ga0436363_1456788 | 3300039450 | Bacteria | 1349 |
| 82 | Ga0439453_0024532 | 3300041408 | Bacteria | 1107 |
| 83 | Ga0466972_0003752 | 3300044658 | Bacteria | 7554 |
| 84 | Ga0466968_0132708 | 3300044735 | Bacteria | 1134 |
| 85 | Ga0495592_0052526 | 3300046454 | Bacteria | 3026 |
| 86 | Ga0495592_0205810 | 3300046454 | Bacteria | 1325 |
| 87 | Ga0495603_0006649 | 3300046455 | Bacteria | 6937 |
| 88 | Ga0495603_0453852 | 3300046455 | Bacteria | 734 |
| 89 | Ga0495629_0360265 | 3300046459 | Bacteria | 991 |
| 90 | Ga0495651_0129584 | 3300046462 | Bacteria | 1843 |
| 91 | Ga0495651_0392514 | 3300046462 | Unclassified | 908 |
| 92 | Ga0495653_0054654 | 3300046463 | Bacteria | 3050 |
| 93 | Ga0495653_0175754 | 3300046463 | Unclassified | 1474 |
| 94 | Ga0495650_0042960 | 3300046471 | Bacteria | 1922 |
| 95 | Ga0495580_0208444 | 3300046472 | Bacteria | 1345 |
| 96 | Ga0495639_0174903 | 3300046475 | Bacteria | 1043 |
| 97 | Ga0495594_0019533 | 3300046499 | Bacteria | 3601 |
| 98 | Ga0495628_0160978 | 3300046516 | Bacteria | 1706 |
| 99 | Ga0495628_0789805 | 3300046516 | Unclassified | 665 |
| 100 | Ga0495652_0292381 | 3300046529 | Bacteria | 1188 |
| 101 | Ga0495640_0009393 | 3300046533 | Bacteria | 7616 |
| 102 | Ga0495640_0051867 | 3300046533 | Bacteria | 2818 |
| 103 | Ga0495645_0309237 | 3300046543 | Bacteria | 1030 |
| 104 | Ga0495634_0005556 | 3300046642 | Bacteria | 9676 |
| 105 | Ga0495634_0252326 | 3300046642 | Bacteria | 1079 |
| 106 | Ga0495635_0441300 | 3300046663 | Bacteria | 861 |
| 107 | Ga0495599_0159659 | 3300046678 | Bacteria | 1394 |
| 108 | Ga0495599_0551179 | 3300046678 | Unclassified | 675 |
| 109 | Ga0495646_0297766 | 3300046680 | Unclassified | 854 |
| 110 | Ga0495658_0042978 | 3300046683 | Bacteria | 2525 |
| 111 | Ga0495581_0202311 | 3300047315 | Unclassified | 1162 |
| 112 | Ga0495674_0016222 | 3300047319 | Bacteria | 6949 |
| 113 | Ga0495674_0051301 | 3300047319 | Bacteria | 3637 |
| 114 | Ga0495674_0943388 | 3300047319 | Bacteria | 664 |
| 115 | Ga0495676_0011110 | 3300047321 | Bacteria | 8136 |
| 116 | Ga0495684_0272591 | 3300047471 | Bacteria | 1224 |
| 117 | Ga0495602_0128246 | 3300048088 | Bacteria | 2028 |
| 118 | Ga0495602_0350981 | 3300048088 | Bacteria | 1065 |
| 119 | Ga0496101_0582015 | 3300048904 | Bacteria | 885 |
| 120 | Ga0496102_0030189 | 3300048905 | Bacteria | 4851 |
| 121 | Ga0496104_0006986 | 3300048907 | Bacteria | 9954 |
| 122 | Ga0496104_0224411 | 3300048907 | Bacteria | 1791 |
| 123 | Ga0496104_0823686 | 3300048907 | Bacteria | 834 |
| 124 | Ga0496105_0746126 | 3300048908 | Unclassified | 748 |
| 125 | Ga0496107_0670191 | 3300048910 | Bacteria | 764 |
| 126 | Ga0496108_0007476 | 3300048911 | Bacteria | 8855 |
| 127 | Ga0496109_0002631 | 3300048912 | Bacteria | 15054 |
| 128 | Ga0496110_1177918 | 3300048913 | Bacteria | 675 |
| 129 | Ga0496111_0202239 | 3300048914 | Bacteria | 1476 |
| 130 | Ga0496112_0014485 | 3300048915 | Bacteria | 7320 |
| 131 | Ga0496112_0915704 | 3300048915 | Unclassified | 798 |
| 132 | Ga0496113_0012736 | 3300048916 | Bacteria | 5664 |
| 133 | Ga0496113_0338559 | 3300048916 | Bacteria | 1206 |
| 134 | Ga0496113_0968862 | 3300048916 | Unclassified | 671 |
| 135 | Ga0496114_0852572 | 3300048917 | Bacteria | 791 |
| 136 | Ga0496115_0242937 | 3300048918 | Bacteria | 1484 |
| 137 | nmdc:mga05p37_24256_c1 | 3300050507 | Bacteria | 4604 |
| 138 | Ga0495601_0013199 | 3300053077 | Bacteria | 4967 |
| 139 | Ga0495601_0026028 | 3300053077 | Bacteria | 3610 |
| 140 | Ga0495601_0073703 | 3300053077 | Unclassified | 2183 |
| 141 | Ga0495601_0114153 | 3300053077 | Bacteria | 1751 |
| 142 | Ga0495601_0207412 | 3300053077 | Bacteria | 1280 |
| 143 | Ga0495612_0074102 | 3300053078 | Bacteria | 1423 |
| 144 | Ga0495612_0258680 | 3300053078 | Unclassified | 775 |
| 145 | Ga0495619_0004945 | 3300053085 | Bacteria | 8466 |
| 146 | Ga0495619_0021335 | 3300053085 | Bacteria | 4133 |
| 147 | Ga0495619_0098446 | 3300053085 | Bacteria | 1988 |
| 148 | Ga0495619_0138804 | 3300053085 | Bacteria | 1673 |
| 149 | Ga0500643_001014 | 3300053087 | Bacteria | 17133 |
| 150 | Ga0500641_0006498 | 3300053096 | Bacteria | 4147 |
| 151 | 2849077954 | 2849076700 | Bacteria | 7039503 |
| 152 | Ga0373927_0102161 | |||
| 153 | Ga0070683_100303706 | |||
| 154 | Ga0070667_100877676 | |||
| 155 | Ga0070709_10149754 | |||
| 156 | Ga0070713_101037026 | |||
| 157 | Ga0070710_10001345 | |||
| 158 | Ga0070710_10007825 | |||
| 159 | Ga0070710_10089728 | |||
| 160 | Ga0070711_100015665 | |||
| 161 | Ga0070708_100919867 | |||
| 162 | Ga0070706_100027600 | |||
| 163 | Ga0070698_100117454 | |||
| 164 | Ga0070684_100783594 | |||
| 165 | Ga0068855_100078984 | |||
| 166 | Ga0068855_100346467 | |||
| 167 | Ga0070717_10144023 | |||
| 168 | Ga0070717_10180939 | |||
| 169 | Ga0070717_10245710 | |||
| 170 | Ga0070716_100023098 | |||
| 171 | Ga0070712_100030756 | |||
| 172 | Ga0070712_100602955 | |||
| 173 | Ga0070712_100793790 | |||
| 174 | Ga0099794_10337725 | |||
| 175 | Ga0099795_10348013 | |||
| 176 | Ga0105240_10033028 | |||
| 177 | Ga0105241_10162149 | |||
| 178 | Ga0105238_10940339 | |||
| 179 | Ga0157370_10048155 | |||
| 180 | Ga0157372_10027260 | |||
| 181 | Ga0157372_10581747 | |||
| 182 | Ga0163163_10242425 | |||
| 183 | Ga0224572_1033849 | |||
| 184 | Ga0228598_1006623 | |||
| 185 | Ga0228598_1034373 | |||
| 186 | Ga0207692_10335750 | |||
| 187 | Ga0207688_10686861 | |||
| 188 | Ga0207699_10005190 | |||
| 189 | Ga0207684_10050814 | |||
| 190 | Ga0207695_10135163 | |||
| 191 | Ga0207671_10575405 | |||
| 192 | Ga0207693_10000773 | |||
| 193 | Ga0207693_10014918 | |||
| 194 | Ga0207693_10026448 | |||
| 195 | Ga0207693_10514891 | |||
| 196 | Ga0207663_10003298 | |||
| 197 | Ga0207659_10712993 | |||
| 198 | Ga0207700_10522616 | |||
| 199 | Ga0207664_10083845 | |||
| 200 | Ga0207665_10066557 | |||
| 201 | Ga0207665_10852548 | |||
| 202 | Ga0207661_10409014 | |||
| 203 | Ga0207667_10080135 | |||
| 204 | Ga0207676_11407417 | |||
| 205 | Ga0265338_10018689 | |||
| 206 | Ga0265338_10044503 | |||
| 207 | Ga0265330_10012385 | |||
| 208 | Ga0265325_10009003 | |||
| 209 | Ga0265325_10014170 | |||
| 210 | Ga0265339_10023060 | |||
| 211 | Ga0307513_10248347 | |||
| 212 | Ga0265313_10003668 | |||
| 213 | Ga0265313_10160046 | |||
| 214 | Ga0373943_0029736 | |||
| 215 | Ga0373946_0101415 | |||
| 216 | Ga0373955_0154664 | |||
| 217 | Ga0373955_0331039 | |||
| 218 | Ga0373935_0022492 | |||
| 219 | Ga0373935_0171867 | |||
| 220 | Ga0373935_0448509 | |||
| 221 | Ga0373935_0559367 | |||
| 222 | Ga0373927_0055202 | |||
| 223 | Ga0373947_0002184 | |||
| 224 | Ga0373947_0501184 | |||
| 225 | Ga0373937_0049499 | |||
| 226 | Ga0373937_0232852 | |||
| 227 | Ga0373925_0023827 | |||
| 228 | Ga0436364_1088620 | |||
| 229 | Ga0436364_1309948 | |||
| 230 | Ga0395901_0082698 | |||
| 231 | Ga0436365_0984862 | |||
| 232 | Ga0436363_1456788 | |||
| 233 | Ga0439453_0024532 | |||
| 234 | Ga0466972_0003752 | |||
| 235 | Ga0466968_0132708 | |||
| 236 | Ga0495592_0052526 | |||
| 237 | Ga0495592_0205810 | |||
| 238 | Ga0495603_0006649 | |||
| 239 | Ga0495603_0453852 | |||
| 240 | Ga0495629_0360265 | |||
| 241 | Ga0495651_0129584 | |||
| 242 | Ga0495651_0392514 | |||
| 243 | Ga0495653_0054654 | |||
| 244 | Ga0495653_0175754 | |||
| 245 | Ga0495650_0042960 | |||
| 246 | Ga0495580_0208444 | |||
| 247 | Ga0495639_0174903 | |||
| 248 | Ga0495594_0019533 | |||
| 249 | Ga0495628_0160978 | |||
| 250 | Ga0495628_0789805 | |||
| 251 | Ga0495652_0292381 | |||
| 252 | Ga0495640_0009393 | |||
| 253 | Ga0495640_0051867 | |||
| 254 | Ga0495645_0309237 | |||
| 255 | Ga0495634_0005556 | |||
| 256 | Ga0495634_0252326 | |||
| 257 | Ga0495635_0441300 | |||
| 258 | Ga0495599_0159659 | |||
| 259 | Ga0495599_0551179 | |||
| 260 | Ga0495646_0297766 | |||
| 261 | Ga0495658_0042978 | |||
| 262 | Ga0495581_0202311 | |||
| 263 | Ga0495674_0016222 | |||
| 264 | Ga0495674_0051301 | |||
| 265 | Ga0495674_0943388 | |||
| 266 | Ga0495676_0011110 | |||
| 267 | Ga0495684_0272591 | |||
| 268 | Ga0495602_0128246 | |||
| 269 | Ga0495602_0350981 | |||
| 270 | Ga0496101_0582015 | |||
| 271 | Ga0496102_0030189 | |||
| 272 | Ga0496104_0006986 | |||
| 273 | Ga0496104_0224411 | |||
| 274 | Ga0496104_0823686 | |||
| 275 | Ga0496105_0746126 | |||
| 276 | Ga0496107_0670191 | |||
| 277 | Ga0496108_0007476 | |||
| 278 | Ga0496109_0002631 | |||
| 279 | Ga0496110_1177918 | |||
| 280 | Ga0496111_0202239 | |||
| 281 | Ga0496112_0014485 | |||
| 282 | Ga0496112_0915704 | |||
| 283 | Ga0496113_0012736 | |||
| 284 | Ga0496113_0338559 | |||
| 285 | Ga0496113_0968862 | |||
| 286 | Ga0496114_0852572 | |||
| 287 | Ga0496115_0242937 | |||
| 288 | nmdc:mga05p37_24256_c1 | |||
| 289 | Ga0495601_0013199 | |||
| 290 | Ga0495601_0026028 | |||
| 291 | Ga0495601_0073703 | |||
| 292 | Ga0495601_0114153 | |||
| 293 | Ga0495601_0207412 | |||
| 294 | Ga0495612_0074102 | |||
| 295 | Ga0495612_0258680 | |||
| 296 | Ga0495619_0004945 | |||
| 297 | Ga0495619_0021335 | |||
| 298 | Ga0495619_0098446 | |||
| 299 | Ga0495619_0138804 | |||
| 300 | Ga0500643_001014 | |||
| 301 | Ga0500641_0006498 | |||
| 302 | 2849077954 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1aih-assembly2.cif.gz_C | catalytic domain of bacteriophage hp1 integrase | 0.737 | 8 | 189 |
| 5hxy-assembly4.cif.gz_D | crystal structure of xera recombinase | 0.736 | 7 | 190 |
| 5hxy-assembly6.cif.gz_F | crystal structure of xera recombinase | 0.7302 | 8 | 190 |
| 5hxy-assembly3.cif.gz_C | crystal structure of xera recombinase | 0.7183 | 1 | 190 |
| 5hxy-assembly2.cif.gz_B | crystal structure of xera recombinase | 0.7143 | 3 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8P6_113_288_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.7655 | 9 | 188 | 1.10.443.10 |
| af_P0ADH5_4_190_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.7643 | 3 | 186 | 1.10.443.10 |
| af_Q2FY74_109_289_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.7565 | 7 | 189 | 1.10.443.10 |
| af_P0A8P6_113_288_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.7541 | 9 | 188 | 1.10.443.10 |
| af_Q2FY74_109_289_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.749 | 7 | 189 | 1.10.443.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W9BFS6-F1-model_v4 | Integrase | 0.9853 | 7 | 95 |
GO:0003677
GO:0006310 GO:0015074 |
| AF-A8U2Z5-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9382 | 1 | 124 |
GO:0003677
GO:0006310 GO:0008661 GO:0015074 |
| AF-B6AWF7-F1-model_v4 | Integrase | 0.934 | 1 | 122 |
GO:0003677
GO:0006310 GO:0015074 |
| AF-A0A7W9BFS6-F1-model_v4 | Integrase | 0.9238 | 7 | 95 |
GO:0003677
GO:0006310 GO:0015074 |
| AF-X1QC20-F1-model_v4 | Tyr recombinase domain-containing protein | 0.92 | 28 | 97 |
GO:0003677
GO:0006310 GO:0015074 |