F212135

General Info

Members Datasets Scaffolds Average Seq Length
151 103 302 194

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0102161|Ga0373927_0102161_932_1621
Length 229
Sequence VTAEGFAMLFVCVDPDFSVASMADAASISHRTYFRRARCQDRQAKLLSDQHLTNLLRFAQASRYPARNRLIVLLSFKAGLRAAEIANLTWAMVVDATGAIAPVIELHDQAAKNRGGRRIPVHPDLYIALSRWRDLSPSTGLMITSERGDAMRPRSIVNWFAYAYRRIGLEGCSSHSGRRTFITRAARLVHKTGGSLRDVQLLAGHRSIQTTQRYIDGDTEAQRKLVSLI

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
25 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
26 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
47 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
48 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
49 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
50 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
51 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
67 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
100 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
101 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0.66
Rhizoplane 11.92
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 21.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0102161 3300035695 Bacteria 1865
2 Ga0070683_100303706 3300005329 Bacteria 1518
3 Ga0070667_100877676 3300005367 Bacteria 834
4 Ga0070709_10149754 3300005434 Bacteria 1611
5 Ga0070713_101037026 3300005436 Unclassified 792
6 Ga0070710_10001345 3300005437 Bacteria 11609
7 Ga0070710_10007825 3300005437 Bacteria 5186
8 Ga0070710_10089728 3300005437 Bacteria 1811
9 Ga0070711_100015665 3300005439 Unclassified 4799
10 Ga0070708_100919867 3300005445 Bacteria 821
11 Ga0070706_100027600 3300005467 Bacteria 5224
12 Ga0070698_100117454 3300005471 Bacteria 2622
13 Ga0070684_100783594 3300005535 Bacteria 891
14 Ga0068855_100078984 3300005563 Bacteria 3817
15 Ga0068855_100346467 3300005563 Bacteria 1637
16 Ga0070717_10144023 3300006028 Bacteria 2057
17 Ga0070717_10180939 3300006028 Unclassified 1837
18 Ga0070717_10245710 3300006028 Unclassified 1580
19 Ga0070716_100023098 3300006173 Bacteria 3294
20 Ga0070712_100030756 3300006175 Bacteria 3613
21 Ga0070712_100602955 3300006175 Unclassified 930
22 Ga0070712_100793790 3300006175 Unclassified 812
23 Ga0099794_10337725 3300007265 Unclassified 783
24 Ga0099795_10348013 3300007788 Unclassified 662
25 Ga0105240_10033028 3300009093 Bacteria 6690
26 Ga0105241_10162149 3300009174 Bacteria 1839
27 Ga0105238_10940339 3300009551 Bacteria 884
28 Ga0157370_10048155 3300013104 Unclassified 4084
29 Ga0157372_10027260 3300013307 Bacteria 6220
30 Ga0157372_10581747 3300013307 Bacteria 1305
31 Ga0163163_10242425 3300014325 Bacteria 1852
32 Ga0224572_1033849 3300024225 Unclassified 971
33 Ga0228598_1006623 3300024227 Bacteria 2392
34 Ga0228598_1034373 3300024227 Bacteria 999
35 Ga0207692_10335750 3300025898 Bacteria 928
36 Ga0207688_10686861 3300025901 Bacteria 647
37 Ga0207699_10005190 3300025906 Bacteria 6230
38 Ga0207684_10050814 3300025910 Bacteria 3518
39 Ga0207695_10135163 3300025913 Unclassified 2419
40 Ga0207671_10575405 3300025914 Unclassified 898
41 Ga0207693_10000773 3300025915 Bacteria 28744
42 Ga0207693_10014918 3300025915 Bacteria 6240
43 Ga0207693_10026448 3300025915 Unclassified 4593
44 Ga0207693_10514891 3300025915 Unclassified 934
45 Ga0207663_10003298 3300025916 Bacteria 7868
46 Ga0207659_10712993 3300025926 Bacteria 859
47 Ga0207700_10522616 3300025928 Bacteria 1052
48 Ga0207664_10083845 3300025929 Bacteria 2598
49 Ga0207665_10066557 3300025939 Unclassified 2452
50 Ga0207665_10852548 3300025939 Unclassified 721
51 Ga0207661_10409014 3300025944 Bacteria 1231
52 Ga0207667_10080135 3300025949 Bacteria 3383
53 Ga0207676_11407417 3300026095 Bacteria 693
54 Ga0265338_10018689 3300028800 Bacteria 7407
55 Ga0265338_10044503 3300028800 Bacteria 4097
56 Ga0265330_10012385 3300031235 Bacteria 3989
57 Ga0265325_10009003 3300031241 Bacteria 5860
58 Ga0265325_10014170 3300031241 Unclassified 4514
59 Ga0265339_10023060 3300031249 Bacteria 3601
60 Ga0307513_10248347 3300031456 Bacteria 1578
61 Ga0265313_10003668 3300031595 Bacteria 12277
62 Ga0265313_10160046 3300031595 Unclassified 957
63 Ga0373943_0029736 3300035170 Unclassified 2582
64 Ga0373946_0101415 3300035171 Bacteria 1291
65 Ga0373955_0154664 3300035172 Bacteria 1351
66 Ga0373955_0331039 3300035172 Unclassified 921
67 Ga0373935_0022492 3300035692 Bacteria 3867
68 Ga0373935_0171867 3300035692 Bacteria 1483
69 Ga0373935_0448509 3300035692 Bacteria 932
70 Ga0373935_0559367 3300035692 Bacteria 834
71 Ga0373927_0055202 3300035695 Bacteria 2569
72 Ga0373947_0002184 3300035725 Bacteria 11875
73 Ga0373947_0501184 3300035725 Unclassified 825
74 Ga0373937_0049499 3300036401 Bacteria 3848
75 Ga0373937_0232852 3300036401 Unclassified 1735
76 Ga0373925_0023827 3300037068 Bacteria 4465
77 Ga0436364_1088620 3300037853 Bacteria 6418
78 Ga0436364_1309948 3300037853 Bacteria 707
79 Ga0395901_0082698 3300038443 Bacteria 3355
80 Ga0436365_0984862 3300039437 Bacteria 1025
81 Ga0436363_1456788 3300039450 Bacteria 1349
82 Ga0439453_0024532 3300041408 Bacteria 1107
83 Ga0466972_0003752 3300044658 Bacteria 7554
84 Ga0466968_0132708 3300044735 Bacteria 1134
85 Ga0495592_0052526 3300046454 Bacteria 3026
86 Ga0495592_0205810 3300046454 Bacteria 1325
87 Ga0495603_0006649 3300046455 Bacteria 6937
88 Ga0495603_0453852 3300046455 Bacteria 734
89 Ga0495629_0360265 3300046459 Bacteria 991
90 Ga0495651_0129584 3300046462 Bacteria 1843
91 Ga0495651_0392514 3300046462 Unclassified 908
92 Ga0495653_0054654 3300046463 Bacteria 3050
93 Ga0495653_0175754 3300046463 Unclassified 1474
94 Ga0495650_0042960 3300046471 Bacteria 1922
95 Ga0495580_0208444 3300046472 Bacteria 1345
96 Ga0495639_0174903 3300046475 Bacteria 1043
97 Ga0495594_0019533 3300046499 Bacteria 3601
98 Ga0495628_0160978 3300046516 Bacteria 1706
99 Ga0495628_0789805 3300046516 Unclassified 665
100 Ga0495652_0292381 3300046529 Bacteria 1188
101 Ga0495640_0009393 3300046533 Bacteria 7616
102 Ga0495640_0051867 3300046533 Bacteria 2818
103 Ga0495645_0309237 3300046543 Bacteria 1030
104 Ga0495634_0005556 3300046642 Bacteria 9676
105 Ga0495634_0252326 3300046642 Bacteria 1079
106 Ga0495635_0441300 3300046663 Bacteria 861
107 Ga0495599_0159659 3300046678 Bacteria 1394
108 Ga0495599_0551179 3300046678 Unclassified 675
109 Ga0495646_0297766 3300046680 Unclassified 854
110 Ga0495658_0042978 3300046683 Bacteria 2525
111 Ga0495581_0202311 3300047315 Unclassified 1162
112 Ga0495674_0016222 3300047319 Bacteria 6949
113 Ga0495674_0051301 3300047319 Bacteria 3637
114 Ga0495674_0943388 3300047319 Bacteria 664
115 Ga0495676_0011110 3300047321 Bacteria 8136
116 Ga0495684_0272591 3300047471 Bacteria 1224
117 Ga0495602_0128246 3300048088 Bacteria 2028
118 Ga0495602_0350981 3300048088 Bacteria 1065
119 Ga0496101_0582015 3300048904 Bacteria 885
120 Ga0496102_0030189 3300048905 Bacteria 4851
121 Ga0496104_0006986 3300048907 Bacteria 9954
122 Ga0496104_0224411 3300048907 Bacteria 1791
123 Ga0496104_0823686 3300048907 Bacteria 834
124 Ga0496105_0746126 3300048908 Unclassified 748
125 Ga0496107_0670191 3300048910 Bacteria 764
126 Ga0496108_0007476 3300048911 Bacteria 8855
127 Ga0496109_0002631 3300048912 Bacteria 15054
128 Ga0496110_1177918 3300048913 Bacteria 675
129 Ga0496111_0202239 3300048914 Bacteria 1476
130 Ga0496112_0014485 3300048915 Bacteria 7320
131 Ga0496112_0915704 3300048915 Unclassified 798
132 Ga0496113_0012736 3300048916 Bacteria 5664
133 Ga0496113_0338559 3300048916 Bacteria 1206
134 Ga0496113_0968862 3300048916 Unclassified 671
135 Ga0496114_0852572 3300048917 Bacteria 791
136 Ga0496115_0242937 3300048918 Bacteria 1484
137 nmdc:mga05p37_24256_c1 3300050507 Bacteria 4604
138 Ga0495601_0013199 3300053077 Bacteria 4967
139 Ga0495601_0026028 3300053077 Bacteria 3610
140 Ga0495601_0073703 3300053077 Unclassified 2183
141 Ga0495601_0114153 3300053077 Bacteria 1751
142 Ga0495601_0207412 3300053077 Bacteria 1280
143 Ga0495612_0074102 3300053078 Bacteria 1423
144 Ga0495612_0258680 3300053078 Unclassified 775
145 Ga0495619_0004945 3300053085 Bacteria 8466
146 Ga0495619_0021335 3300053085 Bacteria 4133
147 Ga0495619_0098446 3300053085 Bacteria 1988
148 Ga0495619_0138804 3300053085 Bacteria 1673
149 Ga0500643_001014 3300053087 Bacteria 17133
150 Ga0500641_0006498 3300053096 Bacteria 4147
151 2849077954 2849076700 Bacteria 7039503
152 Ga0373927_0102161
153 Ga0070683_100303706
154 Ga0070667_100877676
155 Ga0070709_10149754
156 Ga0070713_101037026
157 Ga0070710_10001345
158 Ga0070710_10007825
159 Ga0070710_10089728
160 Ga0070711_100015665
161 Ga0070708_100919867
162 Ga0070706_100027600
163 Ga0070698_100117454
164 Ga0070684_100783594
165 Ga0068855_100078984
166 Ga0068855_100346467
167 Ga0070717_10144023
168 Ga0070717_10180939
169 Ga0070717_10245710
170 Ga0070716_100023098
171 Ga0070712_100030756
172 Ga0070712_100602955
173 Ga0070712_100793790
174 Ga0099794_10337725
175 Ga0099795_10348013
176 Ga0105240_10033028
177 Ga0105241_10162149
178 Ga0105238_10940339
179 Ga0157370_10048155
180 Ga0157372_10027260
181 Ga0157372_10581747
182 Ga0163163_10242425
183 Ga0224572_1033849
184 Ga0228598_1006623
185 Ga0228598_1034373
186 Ga0207692_10335750
187 Ga0207688_10686861
188 Ga0207699_10005190
189 Ga0207684_10050814
190 Ga0207695_10135163
191 Ga0207671_10575405
192 Ga0207693_10000773
193 Ga0207693_10014918
194 Ga0207693_10026448
195 Ga0207693_10514891
196 Ga0207663_10003298
197 Ga0207659_10712993
198 Ga0207700_10522616
199 Ga0207664_10083845
200 Ga0207665_10066557
201 Ga0207665_10852548
202 Ga0207661_10409014
203 Ga0207667_10080135
204 Ga0207676_11407417
205 Ga0265338_10018689
206 Ga0265338_10044503
207 Ga0265330_10012385
208 Ga0265325_10009003
209 Ga0265325_10014170
210 Ga0265339_10023060
211 Ga0307513_10248347
212 Ga0265313_10003668
213 Ga0265313_10160046
214 Ga0373943_0029736
215 Ga0373946_0101415
216 Ga0373955_0154664
217 Ga0373955_0331039
218 Ga0373935_0022492
219 Ga0373935_0171867
220 Ga0373935_0448509
221 Ga0373935_0559367
222 Ga0373927_0055202
223 Ga0373947_0002184
224 Ga0373947_0501184
225 Ga0373937_0049499
226 Ga0373937_0232852
227 Ga0373925_0023827
228 Ga0436364_1088620
229 Ga0436364_1309948
230 Ga0395901_0082698
231 Ga0436365_0984862
232 Ga0436363_1456788
233 Ga0439453_0024532
234 Ga0466972_0003752
235 Ga0466968_0132708
236 Ga0495592_0052526
237 Ga0495592_0205810
238 Ga0495603_0006649
239 Ga0495603_0453852
240 Ga0495629_0360265
241 Ga0495651_0129584
242 Ga0495651_0392514
243 Ga0495653_0054654
244 Ga0495653_0175754
245 Ga0495650_0042960
246 Ga0495580_0208444
247 Ga0495639_0174903
248 Ga0495594_0019533
249 Ga0495628_0160978
250 Ga0495628_0789805
251 Ga0495652_0292381
252 Ga0495640_0009393
253 Ga0495640_0051867
254 Ga0495645_0309237
255 Ga0495634_0005556
256 Ga0495634_0252326
257 Ga0495635_0441300
258 Ga0495599_0159659
259 Ga0495599_0551179
260 Ga0495646_0297766
261 Ga0495658_0042978
262 Ga0495581_0202311
263 Ga0495674_0016222
264 Ga0495674_0051301
265 Ga0495674_0943388
266 Ga0495676_0011110
267 Ga0495684_0272591
268 Ga0495602_0128246
269 Ga0495602_0350981
270 Ga0496101_0582015
271 Ga0496102_0030189
272 Ga0496104_0006986
273 Ga0496104_0224411
274 Ga0496104_0823686
275 Ga0496105_0746126
276 Ga0496107_0670191
277 Ga0496108_0007476
278 Ga0496109_0002631
279 Ga0496110_1177918
280 Ga0496111_0202239
281 Ga0496112_0014485
282 Ga0496112_0915704
283 Ga0496113_0012736
284 Ga0496113_0338559
285 Ga0496113_0968862
286 Ga0496114_0852572
287 Ga0496115_0242937
288 nmdc:mga05p37_24256_c1
289 Ga0495601_0013199
290 Ga0495601_0026028
291 Ga0495601_0073703
292 Ga0495601_0114153
293 Ga0495601_0207412
294 Ga0495612_0074102
295 Ga0495612_0258680
296 Ga0495619_0004945
297 Ga0495619_0021335
298 Ga0495619_0098446
299 Ga0495619_0138804
300 Ga0500643_001014
301 Ga0500641_0006498
302 2849077954

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

45

221

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1aih-assembly2.cif.gz_C catalytic domain of bacteriophage hp1 integrase 0.737 8 189
5hxy-assembly4.cif.gz_D crystal structure of xera recombinase 0.736 7 190
5hxy-assembly6.cif.gz_F crystal structure of xera recombinase 0.7302 8 190
5hxy-assembly3.cif.gz_C crystal structure of xera recombinase 0.7183 1 190
5hxy-assembly2.cif.gz_B crystal structure of xera recombinase 0.7143 3 190
ID Description Score Start End Superfamily
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.7655 9 188 1.10.443.10
af_P0ADH5_4_190_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.7643 3 186 1.10.443.10
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.7565 7 189 1.10.443.10
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.7541 9 188 1.10.443.10
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.749 7 189 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A7W9BFS6-F1-model_v4 Integrase 0.9853 7 95 GO:0003677
GO:0006310
GO:0015074
AF-A8U2Z5-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9382 1 124 GO:0003677
GO:0006310
GO:0008661
GO:0015074
AF-B6AWF7-F1-model_v4 Integrase 0.934 1 122 GO:0003677
GO:0006310
GO:0015074
AF-A0A7W9BFS6-F1-model_v4 Integrase 0.9238 7 95 GO:0003677
GO:0006310
GO:0015074
AF-X1QC20-F1-model_v4 Tyr recombinase domain-containing protein 0.92 28 97 GO:0003677
GO:0006310
GO:0015074

Map