F211123

General Info

Members Datasets Scaffolds Average Seq Length
151 100 302 816

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100047719|Ga0068862_1000477192
Length 846
Sequence MSLIEPALNHFVPFVLFCGINKLMPREITDRGRVVEAIQNLALTAELFEEKDGKQKYAGDLEVIVQGRDYGNGKRVGPYVRLLAYDGSEEIMRQGEWGGNTFYITVEGALDVYVHDTAGQKKIGQLERGSCFGEMALLAGIERNATVAVPANQKAVVLEVTRPALRLLRKLTTFGNILDETYRKHGIGRVLEDLRLLTDKPLSEPLAAELQRTARYMVYGKNHVLCKEGEPIDRLILIKSGWVRRSHGVFFDAASPEVVLGMDEGIGVDFLGGGSCLGSEGVIQPEKWKYRAGVMARTEVLEIPLDVFSSDPQLRKQLVELFAKFSTSGSALPVTIEAVPDLNALKAAEEEITTGIIDGTNVLVMDMDLCIRCGNCSLACHKMHGQSRLLRRGIQIERPVAIGKKRLQHALVPQVCMHCADPECMTGCPTGSISRASFGQIDIDKLTCIGCFDCATQCPYDAITMVPRAAPPPNSGFASTLKKALSFKIDPPVAPEASDDLVAIKCNLCEDTPLNPAGVRRKKYSCEENCPTGALVRVDPIEYFGEMGPAQNFVFRDQTHAVGRNIHKSDPLARAWHIGGAALTILSAIAIGWAIFRYGYDAVLAGGWLTMRWLTGLVXXXXVAVVMSYPLRKQVYRRRVGALRYWMLAHVYVGAVAGVVLLLHSGTRTGGLLTSLLYIAFDLTLLSGIVGIISYYVAPRIMTRIEGDPLLVEDLEGRRKELLSDVRTILEKSDGWLKEEIRDRVYPRFLSYGFLWRQISRREELKALLAQARQEFKDRTTRQATDEERDLLLAAVQTAVTLRRVDALLMLHWLLRAWIPLHIIATAVMLALMLVHVGQVVFFNVR

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
90 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.99
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100047719 3300005844 Bacteria 3656
2 SwRhRL2b_contig_296695 2162886007 Bacteria 4134
3 CNAas_1000060 3300000532 Bacteria 8019
4 JGI24751J29686_10000125 3300002459 Bacteria 38661
5 Ga0065714_10064457 3300005288 Bacteria 69065
6 Ga0065704_10002548 3300005289 Bacteria 9886
7 Ga0065712_10067742 3300005290 Bacteria 73878
8 Ga0065712_10069186 3300005290 Bacteria 7777
9 Ga0065715_10004233 3300005293 Bacteria 4252
10 Ga0065715_10089412 3300005293 Bacteria 10449
11 Ga0065715_10090710 3300005293 Bacteria 6564
12 Ga0065707_10001836 3300005295 Bacteria 11124
13 Ga0065707_10002308 3300005295 Bacteria 9116
14 Ga0065707_10095356 3300005295 Bacteria 3388
15 Ga0070670_100000118 3300005331 Bacteria 73231
16 Ga0068869_100014645 3300005334 Bacteria 5244
17 Ga0070682_100001479 3300005337 Bacteria 13173
18 Ga0070682_100002303 3300005337 Bacteria 10556
19 Ga0070687_100002757 3300005343 Bacteria 6669
20 Ga0070668_100004218 3300005347 Bacteria 10663
21 Ga0070669_100001995 3300005353 Bacteria 14767
22 Ga0070669_100013178 3300005353 Bacteria 5877
23 Ga0070673_100031439 3300005364 Bacteria 3983
24 Ga0070703_10000256 3300005406 Bacteria 25779
25 Ga0070703_10002066 3300005406 Bacteria 5855
26 Ga0070705_100029771 3300005440 Bacteria 3008
27 Ga0070700_100000115 3300005441 Bacteria 51077
28 Ga0070700_100005296 3300005441 Bacteria 6819
29 Ga0070700_100007056 3300005441 Bacteria 6038
30 Ga0070694_100006347 3300005444 Bacteria 7174
31 Ga0070694_100008237 3300005444 Bacteria 6375
32 Ga0070708_100029428 3300005445 Bacteria 4736
33 Ga0070708_100050464 3300005445 Bacteria 3684
34 Ga0070681_10032442 3300005458 Bacteria 5242
35 Ga0070706_100001365 3300005467 Bacteria 25959
36 Ga0070706_100036025 3300005467 Bacteria 4570
37 Ga0070707_100000352 3300005468 Bacteria 45054
38 Ga0070707_100000536 3300005468 Bacteria 37935
39 Ga0070698_100001819 3300005471 Bacteria 23726
40 Ga0070698_100006889 3300005471 Bacteria 12315
41 Ga0070698_100046251 3300005471 Bacteria 4450
42 Ga0070699_100008424 3300005518 Bacteria 8932
43 Ga0070697_100001479 3300005536 Bacteria 17851
44 Ga0070697_100009205 3300005536 Bacteria 7718
45 Ga0068853_100043334 3300005539 Unclassified 3849
46 Ga0070686_100041354 3300005544 Bacteria 2881
47 Ga0070696_100003649 3300005546 Bacteria 10263
48 Ga0070696_100024033 3300005546 Bacteria 4142
49 Ga0070696_100053740 3300005546 Unclassified 2804
50 Ga0070693_100006829 3300005547 Bacteria 5546
51 Ga0070704_100001475 3300005549 Bacteria 12636
52 Ga0068857_100023307 3300005577 Bacteria 5448
53 Ga0068854_100010984 3300005578 Bacteria 5877
54 Ga0070702_100012830 3300005615 Bacteria 4216
55 Ga0068859_100002161 3300005617 Bacteria 19974
56 Ga0068859_100029728 3300005617 Bacteria 5482
57 Ga0068864_100024986 3300005618 Bacteria 5028
58 Ga0068861_100003077 3300005719 Bacteria 11022
59 Ga0068861_100037227 3300005719 Unclassified 3617
60 Ga0068863_100070203 3300005841 Unclassified 3312
61 Ga0068860_100018992 3300005843 Bacteria 6675
62 Ga0068860_100021405 3300005843 Bacteria 6261
63 Ga0068862_100012965 3300005844 Bacteria 6894
64 Ga0081455_10050021 3300005937 Unclassified 3598
65 Ga0081539_10000508 3300005985 Bacteria 80945
66 Ga0081539_10001451 3300005985 Bacteria 40546
67 Ga0081539_10004447 3300005985 Bacteria 15477
68 Ga0070715_10000006 3300006163 Bacteria 216296
69 Ga0070716_100003980 3300006173 Bacteria 7014
70 Ga0075433_10014679 3300006852 Bacteria 6408
71 Ga0075433_10052612 3300006852 Unclassified 3549
72 Ga0097620_100002161 3300006931 Bacteria 19974
73 Ga0097620_100029730 3300006931 Bacteria 5482
74 Ga0111539_10004362 3300009094 Bacteria 18531
75 Ga0111539_10008518 3300009094 Bacteria 13029
76 Ga0105247_10005294 3300009101 Bacteria 8138
77 Ga0114129_10003860 3300009147 Bacteria 21138
78 Ga0114129_10079380 3300009147 Unclassified 4563
79 Ga0114129_10129192 3300009147 Bacteria 3472
80 Ga0105243_10009606 3300009148 Bacteria 7365
81 Ga0105248_10012642 3300009177 Bacteria 9315
82 Ga0105237_10004036 3300009545 Bacteria 17147
83 Ga0105249_10000546 3300009553 Bacteria 34889
84 Ga0105249_10038365 3300009553 Bacteria 4347
85 Ga0105249_10038481 3300009553 Unclassified 4340
86 Ga0157378_10010522 3300013297 Bacteria 8083
87 Ga0157378_10027956 3300013297 Bacteria 4973
88 Ga0163162_10000286 3300013306 Bacteria 46083
89 Ga0163163_10000540 3300014325 Bacteria 33464
90 Ga0163163_10035231 3300014325 Bacteria 4854
91 Ga0163163_10105411 3300014325 Unclassified 2845
92 Ga0157380_10005683 3300014326 Bacteria 8725
93 Ga0157380_10007236 3300014326 Bacteria 7871
94 Ga0157380_10055508 3300014326 Bacteria 3146
95 Ga0157379_10052059 3300014968 Bacteria 3656
96 Ga0207653_10000132 3300025885 Bacteria 53266
97 Ga0207653_10000459 3300025885 Bacteria 16469
98 Ga0207685_10000010 3300025905 Bacteria 216792
99 Ga0207684_10000065 3300025910 Bacteria 194463
100 Ga0207684_10000230 3300025910 Bacteria 85141
101 Ga0207684_10007654 3300025910 Bacteria 9688
102 Ga0207671_10022762 3300025914 Bacteria 4734
103 Ga0207662_10007492 3300025918 Bacteria 5942
104 Ga0207646_10000715 3300025922 Bacteria 43130
105 Ga0207646_10002565 3300025922 Bacteria 21451
106 Ga0207646_10005440 3300025922 Bacteria 13395
107 Ga0207646_10030848 3300025922 Unclassified 4857
108 Ga0207681_10015194 3300025923 Bacteria 4800
109 Ga0207650_10000046 3300025925 Bacteria 178190
110 Ga0207650_10006712 3300025925 Bacteria 7847
111 Ga0207706_10016624 3300025933 Bacteria 6640
112 Ga0207709_10004902 3300025935 Bacteria 7660
113 Ga0207670_10000502 3300025936 Bacteria 21615
114 Ga0207689_10005974 3300025942 Bacteria 10772
115 Ga0207712_10000449 3300025961 Bacteria 34972
116 Ga0207712_10014654 3300025961 Bacteria 5048
117 Ga0207668_10001991 3300025972 Bacteria 11937
118 Ga0207708_10000083 3300026075 Bacteria 74423
119 Ga0207708_10010763 3300026075 Bacteria 6799
120 Ga0207708_10014310 3300026075 Bacteria 5934
121 Ga0207641_10031367 3300026088 Unclassified 4408
122 Ga0207648_10012195 3300026089 Bacteria 8050
123 Ga0207676_10002887 3300026095 Bacteria 12250
124 Ga0207674_10054247 3300026116 Unclassified 4081
125 Ga0207675_100006512 3300026118 Bacteria 11051
126 Ga0207428_10005376 3300027907 Bacteria 11953
127 Ga0207428_10007945 3300027907 Bacteria 9636
128 Ga0207428_10014260 3300027907 Bacteria 6915
129 Ga0268265_10015895 3300028380 Bacteria 5162
130 Ga0268264_10022216 3300028381 Bacteria 5179
131 Ga0307408_100023972 3300031548 Bacteria 4161
132 Ga0307413_10006390 3300031824 Bacteria 5374
133 Ga0307406_10011790 3300031901 Bacteria 4964
134 Ga0307407_10001737 3300031903 Bacteria 8127
135 Ga0307412_10028922 3300031911 Bacteria 3474
136 Ga0307414_10012883 3300032004 Bacteria 4962
137 Ga0373937_0043992 3300036401 Bacteria 4078
138 Ga0495663_0006892 3300046525 Bacteria 3134
139 Ga0495598_0001108 3300046537 Bacteria 5175
140 Ga0495621_0000095 3300046539 Bacteria 18053
141 Ga0496106_0030131 3300048909 Bacteria 4045
142 Ga0496106_0043237 3300048909 Unclassified 3380
143 Ga0496109_0000047 3300048912 Bacteria 130578
144 Ga0501038_0003660 3300049574 Bacteria 14324
145 Ga0501072_0001895 3300049588 Bacteria 15584
146 Ga0501235_002457 3300049669 Unclassified 3996
147 nmdc:mga05p37_44021_c1 3300050507 Bacteria 5492
148 nmdc:mga05p37_99003_c1 3300050507 Unclassified 3592
149 nmdc:mga09592_54602_c1 3300050508 Bacteria 3375
150 nmdc:mga08y16_19764_c1 3300050511 Bacteria 7103
151 nmdc:mga0a205_6805_c1 3300050515 Bacteria 10345
152 Ga0068862_100047719
153 SwRhRL2b_contig_296695
154 CNAas_1000060
155 JGI24751J29686_10000125
156 Ga0065714_10064457
157 Ga0065704_10002548
158 Ga0065712_10067742
159 Ga0065712_10069186
160 Ga0065715_10004233
161 Ga0065715_10089412
162 Ga0065715_10090710
163 Ga0065707_10001836
164 Ga0065707_10002308
165 Ga0065707_10095356
166 Ga0070670_100000118
167 Ga0068869_100014645
168 Ga0070682_100001479
169 Ga0070682_100002303
170 Ga0070687_100002757
171 Ga0070668_100004218
172 Ga0070669_100001995
173 Ga0070669_100013178
174 Ga0070673_100031439
175 Ga0070703_10000256
176 Ga0070703_10002066
177 Ga0070705_100029771
178 Ga0070700_100000115
179 Ga0070700_100005296
180 Ga0070700_100007056
181 Ga0070694_100006347
182 Ga0070694_100008237
183 Ga0070708_100029428
184 Ga0070708_100050464
185 Ga0070681_10032442
186 Ga0070706_100001365
187 Ga0070706_100036025
188 Ga0070707_100000352
189 Ga0070707_100000536
190 Ga0070698_100001819
191 Ga0070698_100006889
192 Ga0070698_100046251
193 Ga0070699_100008424
194 Ga0070697_100001479
195 Ga0070697_100009205
196 Ga0068853_100043334
197 Ga0070686_100041354
198 Ga0070696_100003649
199 Ga0070696_100024033
200 Ga0070696_100053740
201 Ga0070693_100006829
202 Ga0070704_100001475
203 Ga0068857_100023307
204 Ga0068854_100010984
205 Ga0070702_100012830
206 Ga0068859_100002161
207 Ga0068859_100029728
208 Ga0068864_100024986
209 Ga0068861_100003077
210 Ga0068861_100037227
211 Ga0068863_100070203
212 Ga0068860_100018992
213 Ga0068860_100021405
214 Ga0068862_100012965
215 Ga0081455_10050021
216 Ga0081539_10000508
217 Ga0081539_10001451
218 Ga0081539_10004447
219 Ga0070715_10000006
220 Ga0070716_100003980
221 Ga0075433_10014679
222 Ga0075433_10052612
223 Ga0097620_100002161
224 Ga0097620_100029730
225 Ga0111539_10004362
226 Ga0111539_10008518
227 Ga0105247_10005294
228 Ga0114129_10003860
229 Ga0114129_10079380
230 Ga0114129_10129192
231 Ga0105243_10009606
232 Ga0105248_10012642
233 Ga0105237_10004036
234 Ga0105249_10000546
235 Ga0105249_10038365
236 Ga0105249_10038481
237 Ga0157378_10010522
238 Ga0157378_10027956
239 Ga0163162_10000286
240 Ga0163163_10000540
241 Ga0163163_10035231
242 Ga0163163_10105411
243 Ga0157380_10005683
244 Ga0157380_10007236
245 Ga0157380_10055508
246 Ga0157379_10052059
247 Ga0207653_10000132
248 Ga0207653_10000459
249 Ga0207685_10000010
250 Ga0207684_10000065
251 Ga0207684_10000230
252 Ga0207684_10007654
253 Ga0207671_10022762
254 Ga0207662_10007492
255 Ga0207646_10000715
256 Ga0207646_10002565
257 Ga0207646_10005440
258 Ga0207646_10030848
259 Ga0207681_10015194
260 Ga0207650_10000046
261 Ga0207650_10006712
262 Ga0207706_10016624
263 Ga0207709_10004902
264 Ga0207670_10000502
265 Ga0207689_10005974
266 Ga0207712_10000449
267 Ga0207712_10014654
268 Ga0207668_10001991
269 Ga0207708_10000083
270 Ga0207708_10010763
271 Ga0207708_10014310
272 Ga0207641_10031367
273 Ga0207648_10012195
274 Ga0207676_10002887
275 Ga0207674_10054247
276 Ga0207675_100006512
277 Ga0207428_10005376
278 Ga0207428_10007945
279 Ga0207428_10014260
280 Ga0268265_10015895
281 Ga0268264_10022216
282 Ga0307408_100023972
283 Ga0307413_10006390
284 Ga0307406_10011790
285 Ga0307407_10001737
286 Ga0307412_10028922
287 Ga0307414_10012883
288 Ga0373937_0043992
289 Ga0495663_0006892
290 Ga0495598_0001108
291 Ga0495621_0000095
292 Ga0496106_0030131
293 Ga0496106_0043237
294 Ga0496109_0000047
295 Ga0501038_0003660
296 Ga0501072_0001895
297 Ga0501235_002457
298 nmdc:mga05p37_44021_c1
299 nmdc:mga05p37_99003_c1
300 nmdc:mga09592_54602_c1
301 nmdc:mga08y16_19764_c1
302 nmdc:mga0a205_6805_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

216

310

0.91

PF13247

Fer4_11

4Fe-4S dicluster domain

407

470

0.9

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

82

170

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d1i-assembly1.cif.gz_B structure of cyclic nucleotide-binding-like protein from brucella abortus bv. 1 str. 9-941 0.8068 57 147
4ku8-assembly2.cif.gz_B structures of pkgi reveal a cgmp-selective activation mechanism 0.806 55 142
3mdp-assembly1.cif.gz_A-2 crystal structure of a putative cyclic nucleotide-binding protein (gmet_1532) from geobacter metallireducens gs-15 at 1.90 a resolution 0.788 179 302
3clp-assembly1.cif.gz_A m. loti cyclic-nucleotide binding domain mutant 2 0.7703 7 159
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.7554 8 145
ID Description Score Start End Superfamily
5d1iB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8072 57 147 2.60.120.10
4ku8B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.806 55 142 2.60.120.10
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7938 57 158 2.60.120.10
af_H9CDQ2_735_863_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7886 179 297 2.60.120.10
3mdpA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7859 179 300 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A838N1D0-F1-model_v4 Uncharacterized protein 0.8692 606 823 GO:0016020
AF-A0A838N1D0-F1-model_v4 Uncharacterized protein 0.8619 606 823 GO:0016020
AF-A0A1Q7NLN3-F1-model_v4 Uncharacterized protein 0.8429 517 823 GO:0016020
AF-A0A1Q7NLN3-F1-model_v4 Uncharacterized protein 0.8403 517 823 GO:0016020
AF-A0A6L4Z6D4-F1-model_v4 4Fe-4S binding protein 0.8242 1 278 GO:0005829

Map