F208274

General Info

Members Datasets Scaffolds Average Seq Length
150 113 144 115

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_101188954|Ga0070693_1011889541
Length 135
Sequence MYLSNSLPANRHSVLNHQNLDKMKDFLFVFRSETSPRTNASPEQLQANMKLWMDWIGGIAAQNKLIDRGNRLETGGKVVKPGNLITDGPYIETKEMIGGYTLVKADSIDEATEMAKGCPILTFGGNVEVREIGVM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
94 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
95 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
110 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
111 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
112 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
113 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0
Isolates 4.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.67
Nodule 0
Rhizoplane 1.33
Rhizosphere 66
Stem 0
Stem Tuber 0
Unclassified 22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1515517 2162886007 Bacteria 5425
2 SwRhRL2b_contig_2131875 2162886007 Bacteria 1025
3 JGI25162J39368_1001757 3300002737 Bacteria 10325
4 JGI25158J39367_1011588 3300002739 Bacteria 1173
5 JGI25165J46597_1004837 3300003214 Bacteria 2749
6 rootH1_10067434 3300003316 Bacteria 4121
7 rootH2_10145164 3300003320 Bacteria 1833
8 rootH2_10192741 3300003320 Bacteria 1460
9 rootL2_10047090 3300003322 Bacteria 19846
10 rootL2_10157221 3300003322 Bacteria 2677
11 rootL2_10180071 3300003322 Bacteria 2343
12 rootL2_10240288 3300003322 Bacteria 6125
13 rootL2_10272079 3300003322 Bacteria 3302
14 rootH1_10000671 3300003316 Bacteria 21931
15 rootH1_10000671 3300003323 Bacteria 13833
16 rootH1_10001642 3300003323 Bacteria 53790
17 rootH1_10022931 3300003323 Bacteria 51976
18 rootH1_10039019 3300003323 Bacteria 22093
19 rootH1_10198862 3300003323 Unclassified 1027
20 rootH1_10286856 3300003323 Bacteria 1304
21 Ga0065165_1019855 3300005262 Unclassified 2385
22 Ga0065714_10002411 3300005288 Bacteria 34982
23 Ga0065714_10013282 3300005288 Bacteria 1943
24 Ga0065704_10000289 3300005289 Bacteria 49641
25 Ga0065704_10086980 3300005289 Bacteria 3067
26 Ga0065704_10237541 3300005289 Bacteria 1025
27 Ga0070658_10502740 3300005327 Bacteria 1047
28 Ga0070683_100343651 3300005329 Bacteria 1421
29 Ga0070670_100544311 3300005331 Bacteria 1035
30 Ga0070670_100702422 3300005331 Bacteria 909
31 Ga0070670_101106605 3300005331 Unclassified 722
32 Ga0070674_100011630 3300005356 Bacteria 5363
33 Ga0070678_100069839 3300005456 Bacteria 2624
34 Ga0070662_100184777 3300005457 Bacteria 1645
35 Ga0068867_100210234 3300005459 Bacteria 1562
36 Ga0070684_101706405 3300005535 Bacteria 594
37 Ga0070693_101188954 3300005547 Bacteria 585
38 Ga0068855_101763015 3300005563 Unclassified 630
39 Ga0068857_101094699 3300005577 Bacteria 769
40 Ga0068857_101120715 3300005577 Bacteria 760
41 Ga0068856_100048978 3300005614 Unclassified 4165
42 Ga0068851_10056923 3300005834 Bacteria 1995
43 Ga0068870_10318535 3300005840 Bacteria 987
44 Ga0097621_100596496 3300006237 Bacteria 1009
45 Ga0097621_100886936 3300006237 Unclassified 830
46 Ga0105245_12987751 3300009098 Bacteria 524
47 Ga0105243_10899176 3300009148 Bacteria 880
48 Ga0105241_10342180 3300009174 Bacteria 1296
49 Ga0105242_10136046 3300009176 Bacteria 2127
50 Ga0105242_10347297 3300009176 Bacteria 1369
51 Ga0105237_10003216 3300009545 Bacteria 19562
52 Ga0105238_10020484 3300009551 Bacteria 6733
53 Ga0105239_10000071 3300010375 Bacteria 143060
54 Ga0105239_10000115 3300010375 Bacteria 113217
55 Ga0157373_10000377 3300013100 Bacteria 35725
56 Ga0157371_10001364 3300013102 Bacteria 25627
57 Ga0157371_10170972 3300013102 Bacteria 1553
58 Ga0157370_10069880 3300013104 Bacteria 3316
59 Ga0157370_10132399 3300013104 Bacteria 2325
60 Ga0157370_10256286 3300013104 Bacteria 1617
61 Ga0157374_10003662 3300013296 Bacteria 12921
62 Ga0157374_11019325 3300013296 Bacteria 847
63 Ga0157374_11096412 3300013296 Unclassified 816
64 Ga0157374_11412387 3300013296 Bacteria 719
65 Ga0157372_10548012 3300013307 Bacteria 1348
66 Ga0157375_10250029 3300013308 Unclassified 1933
67 Ga0182008_10000008 3300014497 Bacteria 371823
68 Ga0157376_11995969 3300014969 Unclassified 618
69 Ga0182006_1003844 3300015261 Bacteria 7540
70 Ga0182005_1000061 3300015265 Bacteria 98415
71 Ga0163161_10199685 3300017792 Unclassified 1541
72 Ga0163161_10244562 3300017792 Bacteria 1396
73 Ga0163161_11043380 3300017792 Bacteria 700
74 Ga0163161_11553120 3300017792 Bacteria 582
75 Ga0213876_10140208 3300021384 Bacteria 1286
76 Ga0209436_102665 3300025208 Bacteria 5193
77 Ga0207427_100043 3300025231 Bacteria 249595
78 Ga0209437_100170 3300025233 Bacteria 142489
79 Ga0209437_100237 3300025233 Bacteria 90448
80 Ga0209129_1017048 3300025258 Bacteria 1438
81 Ga0209233_1000266 3300025261 Bacteria 76176
82 Ga0209050_1013220 3300025298 Bacteria 3688
83 Ga0207426_1002566 3300025302 Bacteria 11340
84 Ga0207656_10063739 3300025321 Unclassified 1623
85 Ga0207654_10214980 3300025911 Bacteria 1272
86 Ga0207671_10057660 3300025914 Bacteria 2879
87 Ga0207650_11007780 3300025925 Bacteria 708
88 Ga0207706_10650099 3300025933 Bacteria 903
89 Ga0207686_10222546 3300025934 Bacteria 1364
90 Ga0207686_10712844 3300025934 Bacteria 798
91 Ga0207669_10010459 3300025937 Bacteria 4469
92 Ga0207691_10928768 3300025940 Unclassified 728
93 Ga0207661_10126336 3300025944 Bacteria 2185
94 Ga0207651_10714622 3300025960 Bacteria 884
95 Ga0207640_11475396 3300025981 Bacteria 611
96 Ga0207702_10048777 3300026078 Bacteria 3572
97 Ga0207648_10078495 3300026089 Bacteria 2880
98 Ga0207674_10360953 3300026116 Bacteria 1404
99 Ga0207675_101511522 3300026118 Unclassified 692
100 Ga0207683_10020944 3300026121 Bacteria 5596
101 Ga0207698_11895858 3300026142 Bacteria 611
102 Ga0307515_10000565 3300028794 Bacteria 87276
103 Ga0307515_10326278 3300028794 Bacteria 1197
104 Ga0307511_10000850 3300030521 Bacteria 32503
105 Ga0265327_10018777 3300031251 Bacteria 4274
106 Ga0265316_10796862 3300031344 Unclassified 663
107 Ga0307513_10638524 3300031456 Bacteria 772
108 Ga0307514_10542582 3300031649 Bacteria 539
109 Ga0307516_10000768 3300031730 Bacteria 43795
110 Ga0307412_10000023 3300031911 Bacteria 237005
111 Ga0307412_10560073 3300031911 Bacteria 961
112 Ga0307414_10017841 3300032004 Bacteria 4353
113 Ga0373927_0083025 3300035695 Unclassified 2078
114 Ga0395899_0534883 3300037312 Bacteria 755
115 Ga0395898_0003807 3300037466 Bacteria 16705
116 Ga0395905_1300755 3300037471 Bacteria 631
117 Ga0395901_0073611 3300038443 Bacteria 3563
118 Ga0436365_0518125 3300039437 Bacteria 1600
119 Ga0451789_1078439 3300041443 Bacteria 1064
120 Ga0451802_1364303 3300041460 Bacteria 526
121 Ga0451841_0603137 3300041498 Bacteria 679
122 Ga0451847_0019523 3300041503 Bacteria 728
123 Ga0451849_0426108 3300041505 Bacteria 613
124 Ga0495638_0000013 3300046460 Bacteria 430133
125 Ga0495616_0006803 3300046513 Bacteria 6890
126 Ga0495625_0164996 3300046660 Bacteria 1481
127 Ga0495676_0334603 3300047321 Bacteria 1015
128 Ga0496124_0149525 3300048927 Bacteria 1834
129 Ga0496126_0415312 3300048929 Bacteria 1089
130 Ga0495678_042253 3300049459 Bacteria 1818
131 Ga0501034_0040413 3300049571 Bacteria 4721
132 Ga0501034_0312002 3300049571 Bacteria 1507
133 Ga0501034_0585434 3300049571 Bacteria 1022
134 Ga0501037_0236961 3300049573 Unclassified 1280
135 Ga0501043_0052305 3300049579 Bacteria 3209
136 Ga0501047_0076326 3300049581 Bacteria 3225
137 Ga0501047_0243129 3300049581 Unclassified 1650
138 Ga0501241_003556 3300049758 Unclassified 2943
139 Ga0501241_057633 3300049758 Bacteria 775
140 Ga0501044_0082666 3300049823 Bacteria 3249
141 Ga0500578_0286076 3300053086 Bacteria 982
142 Ga0500651_0000084 3300053093 Bacteria 60127
143 Ga0500562_000058 3300053108 Bacteria 54762
144 Ga0500627_0005475 3300053158 Bacteria 4223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041460 Ga0451802_1364303 Ga0451802_1364303_28_318 91
2 3300017792 Ga0163161_11043380 Ga0163161_110433801 98
3 3300035695 Ga0373927_0083025 Ga0373927_0083025_1661_1996 105
4 3300005614 Ga0068856_100048978 Ga0068856_1000489783 108
5 3300009176 Ga0105242_10136046 Ga0105242_101360464 109
6 3300025934 Ga0207686_10712844 Ga0207686_107128442 109
7 iso_pu_bacteria 2738541284 2738760431 109
8 iso_pu_bacteria 2775506987 2776612546 109
9 iso_pu_bacteria 2818991442 2819575383 109
10 iso_pu_bacteria 2884791551 2884793781 109
11 iso_pu_bacteria 2919437846 2919442584 109
12 iso_pu_bacteria 2929921140 2929924585 109
13 iso_pu_bacteria 8003151029 8003157040 109
14 3300003316 rootH1_10067434 rootH1_100674345 111
15 3300003320 rootH2_10192741 rootH2_101927412 111
16 3300003322 rootL2_10047090 rootL2_1004709013 111
17 3300003323 rootH1_10000671 rootH1_100006714 111
18 3300003323 rootH1_10022931 rootH1_1002293124 111
19 3300005327 Ga0070658_10502740 Ga0070658_105027402 111
20 3300005329 Ga0070683_100343651 Ga0070683_1003436512 111
21 3300005535 Ga0070684_101706405 Ga0070684_1017064052 111
22 3300005563 Ga0068855_101763015 Ga0068855_1017630151 111
23 3300025944 Ga0207661_10126336 Ga0207661_101263362 111
24 3300037312 Ga0395899_0534883 Ga0395899_0534883_125_460 111
25 3300037466 Ga0395898_0003807 Ga0395898_0003807_4481_4816 111
26 3300038443 Ga0395901_0073611 Ga0395901_0073611_2716_3051 111
27 3300053108 Ga0500562_000058 Ga0500562_000058_11699_12085 111
28 3300003322 rootL2_10272079 rootL2_102720793 112
29 3300009148 Ga0105243_10899176 Ga0105243_108991762 112
30 3300025981 Ga0207640_11475396 Ga0207640_114753961 112
31 3300026078 Ga0207702_10048777 Ga0207702_100487775 112
32 3300026142 Ga0207698_11895858 Ga0207698_118958582 112
33 2162886007 SwRhRL2b_contig_1515517 SwRhRL2b_0115.00003000 113
34 2162886007 SwRhRL2b_contig_2131875 SwRhRL2b_0019.00001380 113
35 3300002737 JGI25162J39368_1001757 JGI25162J39368_10017575 113
36 3300002739 JGI25158J39367_1011588 JGI25158J39367_10115882 113
37 3300003214 JGI25165J46597_1004837 JGI25165J46597_10048372 113
38 3300003320 rootH2_10145164 rootH2_101451642 113
39 3300003322 rootL2_10157221 rootL2_101572213 113
40 3300003322 rootL2_10180071 rootL2_101800712 113
41 3300003322 rootL2_10240288 rootL2_102402883 113
42 3300003323 rootH1_10001642 rootH1_1000164236 113
43 3300003323 rootH1_10039019 rootH1_100390192 113
44 3300003323 rootH1_10198862 rootH1_101988621 113
45 3300003323 rootH1_10286856 rootH1_102868562 113
46 3300005262 Ga0065165_1019855 Ga0065165_10198552 113
47 3300005288 Ga0065714_10002411 Ga0065714_100024119 113
48 3300005288 Ga0065714_10013282 Ga0065714_100132822 113
49 3300005289 Ga0065704_10000289 Ga0065704_1000028943 113
50 3300005289 Ga0065704_10086980 Ga0065704_100869803 113
51 3300005289 Ga0065704_10237541 Ga0065704_102375412 113
52 3300005331 Ga0070670_100544311 Ga0070670_1005443112 113
53 3300005331 Ga0070670_100702422 Ga0070670_1007024221 113
54 3300005331 Ga0070670_101106605 Ga0070670_1011066051 113
55 3300005356 Ga0070674_100011630 Ga0070674_1000116304 113
56 3300005456 Ga0070678_100069839 Ga0070678_1000698394 113
57 3300005457 Ga0070662_100184777 Ga0070662_1001847772 113
58 3300005459 Ga0068867_100210234 Ga0068867_1002102342 113
59 3300005547 Ga0070693_101188954 Ga0070693_1011889541 113
60 3300005577 Ga0068857_101094699 Ga0068857_1010946992 113
61 3300005577 Ga0068857_101120715 Ga0068857_1011207152 113
62 3300005834 Ga0068851_10056923 Ga0068851_100569232 113
63 3300005840 Ga0068870_10318535 Ga0068870_103185351 113
64 3300006237 Ga0097621_100596496 Ga0097621_1005964961 113
65 3300006237 Ga0097621_100886936 Ga0097621_1008869362 113
66 3300009098 Ga0105245_12987751 Ga0105245_129877511 113
67 3300009174 Ga0105241_10342180 Ga0105241_103421802 113
68 3300009176 Ga0105242_10347297 Ga0105242_103472972 113
69 3300009545 Ga0105237_10003216 Ga0105237_100032169 113
70 3300009551 Ga0105238_10020484 Ga0105238_100204843 113
71 3300010375 Ga0105239_10000071 Ga0105239_1000007182 113
72 3300010375 Ga0105239_10000115 Ga0105239_1000011599 113
73 3300013100 Ga0157373_10000377 Ga0157373_1000037722 113
74 3300013102 Ga0157371_10001364 Ga0157371_1000136424 113
75 3300013102 Ga0157371_10170972 Ga0157371_101709722 113
76 3300013104 Ga0157370_10069880 Ga0157370_100698803 113
77 3300013104 Ga0157370_10132399 Ga0157370_101323992 113
78 3300013104 Ga0157370_10256286 Ga0157370_102562862 113
79 3300013296 Ga0157374_10003662 Ga0157374_100036624 113
80 3300013296 Ga0157374_11019325 Ga0157374_110193251 113
81 3300013296 Ga0157374_11096412 Ga0157374_110964121 113
82 3300013296 Ga0157374_11412387 Ga0157374_114123871 113
83 3300013307 Ga0157372_10548012 Ga0157372_105480122 113
84 3300013308 Ga0157375_10250029 Ga0157375_102500292 113
85 3300014497 Ga0182008_10000008 Ga0182008_10000008294 113
86 3300014969 Ga0157376_11995969 Ga0157376_119959691 113
87 3300015261 Ga0182006_1003844 Ga0182006_10038442 113
88 3300015265 Ga0182005_1000061 Ga0182005_100006181 113
89 3300017792 Ga0163161_10199685 Ga0163161_101996852 113
90 3300017792 Ga0163161_10244562 Ga0163161_102445621 113
91 3300017792 Ga0163161_11553120 Ga0163161_115531202 113
92 3300021384 Ga0213876_10140208 Ga0213876_101402082 113
93 3300025208 Ga0209436_102665 Ga0209436_1026653 113
94 3300025231 Ga0207427_100043 Ga0207427_1000434 113
95 3300025233 Ga0209437_100170 Ga0209437_100170115 113
96 3300025233 Ga0209437_100237 Ga0209437_10023737 113
97 3300025258 Ga0209129_1017048 Ga0209129_10170481 113
98 3300025261 Ga0209233_1000266 Ga0209233_100026619 113
99 3300025298 Ga0209050_1013220 Ga0209050_10132205 113
100 3300025302 Ga0207426_1002566 Ga0207426_10025668 113
101 3300025321 Ga0207656_10063739 Ga0207656_100637392 113
102 3300025911 Ga0207654_10214980 Ga0207654_102149801 113
103 3300025914 Ga0207671_10057660 Ga0207671_100576602 113
104 3300025925 Ga0207650_11007780 Ga0207650_110077802 113
105 3300025933 Ga0207706_10650099 Ga0207706_106500992 113
106 3300025934 Ga0207686_10222546 Ga0207686_102225462 113
107 3300025937 Ga0207669_10010459 Ga0207669_100104594 113
108 3300025940 Ga0207691_10928768 Ga0207691_109287681 113
109 3300025960 Ga0207651_10714622 Ga0207651_107146222 113
110 3300026089 Ga0207648_10078495 Ga0207648_100784953 113
111 3300026116 Ga0207674_10360953 Ga0207674_103609532 113
112 3300026118 Ga0207675_101511522 Ga0207675_1015115221 113
113 3300026121 Ga0207683_10020944 Ga0207683_100209442 113
114 3300028794 Ga0307515_10000565 Ga0307515_100005657 113
115 3300028794 Ga0307515_10326278 Ga0307515_103262781 113
116 3300030521 Ga0307511_10000850 Ga0307511_1000085024 113
117 3300031251 Ga0265327_10018777 Ga0265327_100187771 113
118 3300031344 Ga0265316_10796862 Ga0265316_107968621 113
119 3300031456 Ga0307513_10638524 Ga0307513_106385241 113
120 3300031649 Ga0307514_10542582 Ga0307514_105425821 113
121 3300031730 Ga0307516_10000768 Ga0307516_100007688 113
122 3300031911 Ga0307412_10000023 Ga0307412_1000002338 113
123 3300031911 Ga0307412_10560073 Ga0307412_105600732 113
124 3300032004 Ga0307414_10017841 Ga0307414_100178412 113
125 3300037471 Ga0395905_1300755 Ga0395905_1300755_173_514 113
126 3300039437 Ga0436365_0518125 Ga0436365_0518125_816_1157 113
127 3300041443 Ga0451789_1078439 Ga0451789_1078439_142_483 113
128 3300041498 Ga0451841_0603137 Ga0451841_0603137_122_523 113
129 3300041503 Ga0451847_0019523 Ga0451847_0019523_263_604 113
130 3300041505 Ga0451849_0426108 Ga0451849_0426108_156_497 113
131 3300046460 Ga0495638_0000013 Ga0495638_0000013_318569_318910 113
132 3300046513 Ga0495616_0006803 Ga0495616_0006803_1372_1713 113
133 3300046660 Ga0495625_0164996 Ga0495625_0164996_210_551 113
134 3300047321 Ga0495676_0334603 Ga0495676_0334603_291_674 113
135 3300048927 Ga0496124_0149525 Ga0496124_0149525_1306_1662 113
136 3300048929 Ga0496126_0415312 Ga0496126_0415312_472_819 113
137 3300049459 Ga0495678_042253 Ga0495678_042253_1266_1607 113
138 3300049571 Ga0501034_0040413 Ga0501034_0040413_1430_1771 113
139 3300049571 Ga0501034_0312002 Ga0501034_0312002_1013_1354 113
140 3300049571 Ga0501034_0585434 Ga0501034_0585434_251_592 113
141 3300049573 Ga0501037_0236961 Ga0501037_0236961_859_1200 113
142 3300049579 Ga0501043_0052305 Ga0501043_0052305_2171_2512 113
143 3300049581 Ga0501047_0076326 Ga0501047_0076326_1280_1621 113
144 3300049581 Ga0501047_0243129 Ga0501047_0243129_537_878 113
145 3300049758 Ga0501241_003556 Ga0501241_003556_2344_2685 113
146 3300049758 Ga0501241_057633 Ga0501241_057633_274_615 113
147 3300049823 Ga0501044_0082666 Ga0501044_0082666_50_391 113
148 3300053086 Ga0500578_0286076 Ga0500578_0286076_175_522 113
149 3300053093 Ga0500651_0000084 Ga0500651_0000084_4194_4535 113
150 3300053158 Ga0500627_0005475 Ga0500627_0005475_1240_1581 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

26

135

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6661 3 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6557 2 112
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.6518 3 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6397 2 112
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6326 3 113
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6557 2 112 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6511 3 113 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6397 2 112 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6304 3 113 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6169 5 113 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A7J5EU96-F1-model_v4 YCII-related domain-containing protein 0.8212 2 113
AF-A0A7J5EU96-F1-model_v4 YCII-related domain-containing protein 0.8015 2 113
AF-A0A7Y4XQS4-F1-model_v4 Transcription initiation protein 0.7602 1 113
AF-A0A448AWP7-F1-model_v4 Uncharacterized protein conserved in bacteria 0.7546 1 113
AF-A0A7Y4XQS4-F1-model_v4 Transcription initiation protein 0.7536 1 113

Feature Viewer

pLDDT pTM Quality
91.22 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map