F208244

General Info

Members Datasets Scaffolds Average Seq Length
150 111 150 92

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100922584|Ga0070684_1009225842
Length 93
Sequence VSDEATGEFEIVNQRGLHARAATKLVQLAGRFPCDIEIVGPDGQVANGKSVMGVLLLCGSMGTVIGVRARGERAKEAVAAIGALVAGRFGELE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
97 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
98 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
99 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
100 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
101 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 4
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100148109 3300005329 Bacteria 2225
2 Ga0070683_100192145 3300005329 Bacteria 1939
3 Ga0070690_100965846 3300005330 Bacteria 670
4 Ga0068869_100650396 3300005334 Bacteria 895
5 Ga0070680_100514422 3300005336 Bacteria 1025
6 Ga0070680_101259906 3300005336 Bacteria 640
7 Ga0070680_101290452 3300005336 Bacteria 632
8 Ga0070682_100208016 3300005337 Bacteria 1385
9 Ga0070689_100201688 3300005340 Bacteria 1625
10 Ga0070674_101006056 3300005356 Bacteria 732
11 Ga0070710_10120971 3300005437 Bacteria 1585
12 Ga0070694_101600409 3300005444 Bacteria 553
13 Ga0070678_100210315 3300005456 Bacteria 1611
14 Ga0070678_102345103 3300005456 Bacteria 507
15 Ga0070681_10055008 3300005458 Bacteria 3964
16 Ga0070681_10457194 3300005458 Unclassified 1189
17 Ga0070685_11292531 3300005466 Bacteria 557
18 Ga0070706_100117816 3300005467 Bacteria 2474
19 Ga0070698_100000632 3300005471 Bacteria 37967
20 Ga0070698_101125943 3300005471 Bacteria 734
21 Ga0070699_100221595 3300005518 Bacteria 1686
22 Ga0070679_100012648 3300005530 Bacteria 8072
23 Ga0070679_100035928 3300005530 Bacteria 4916
24 Ga0070679_100337752 3300005530 Bacteria 1455
25 Ga0070679_100422894 3300005530 Bacteria 1278
26 Ga0070684_100665227 3300005535 Bacteria 970
27 Ga0070684_100727226 3300005535 Bacteria 926
28 Ga0070684_100922584 3300005535 Unclassified 818
29 Ga0070684_101114771 3300005535 Bacteria 742
30 Ga0070697_100174616 3300005536 Bacteria 1820
31 Ga0070697_101291716 3300005536 Bacteria 651
32 Ga0070686_101967544 3300005544 Bacteria 500
33 Ga0070693_101404490 3300005547 Bacteria 543
34 Ga0070665_100003907 3300005548 Bacteria 15753
35 Ga0070704_100809082 3300005549 Bacteria 838
36 Ga0068857_100260135 3300005577 Bacteria 1593
37 Ga0068856_100131271 3300005614 Bacteria 2509
38 Ga0068856_100533700 3300005614 Bacteria 1194
39 Ga0068859_100929500 3300005617 Bacteria 954
40 Ga0068864_100026313 3300005618 Bacteria 4907
41 Ga0097621_100354336 3300006237 Bacteria 1306
42 Ga0068871_100603072 3300006358 Bacteria 999
43 Ga0075430_101273315 3300006846 Bacteria 605
44 Ga0075431_100689389 3300006847 Bacteria 1000
45 Ga0075429_100037211 3300006880 Bacteria 4237
46 Ga0075429_101383595 3300006880 Bacteria 613
47 Ga0075429_101484990 3300006880 Bacteria 590
48 Ga0097620_100929438 3300006931 Bacteria 954
49 Ga0105245_10000083 3300009098 Bacteria 95318
50 Ga0105245_11136458 3300009098 Bacteria 828
51 Ga0114129_11266082 3300009147 Bacteria 916
52 Ga0114129_11444876 3300009147 Bacteria 847
53 Ga0105241_10139091 3300009174 Bacteria 1975
54 Ga0105237_10648280 3300009545 Bacteria 1063
55 Ga0105237_10943753 3300009545 Bacteria 870
56 Ga0105239_10917603 3300010375 Bacteria 1005
57 Ga0157374_10245492 3300013296 Bacteria 1761
58 Ga0157374_11462523 3300013296 Bacteria 706
59 Ga0157376_11750775 3300014969 Bacteria 657
60 Ga0207705_11041282 3300025909 Bacteria 632
61 Ga0207684_10072711 3300025910 Bacteria 2920
62 Ga0207707_10001455 3300025912 Bacteria 21874
63 Ga0207707_10472402 3300025912 Bacteria 1072
64 Ga0207671_10593882 3300025914 Bacteria 882
65 Ga0207660_10058536 3300025917 Bacteria 2763
66 Ga0207660_10106051 3300025917 Bacteria 2107
67 Ga0207652_10050289 3300025921 Bacteria 3570
68 Ga0207652_10160832 3300025921 Bacteria 2013
69 Ga0207652_10380941 3300025921 Bacteria 1273
70 Ga0207652_10803689 3300025921 Bacteria 835
71 Ga0207687_10000404 3300025927 Bacteria 29280
72 Ga0207687_11357232 3300025927 Bacteria 611
73 Ga0207686_10310462 3300025934 Bacteria 1174
74 Ga0207670_10049906 3300025936 Bacteria 2802
75 Ga0207669_10556239 3300025937 Bacteria 926
76 Ga0207711_11903569 3300025941 Bacteria 538
77 Ga0207689_10327187 3300025942 Bacteria 1272
78 Ga0207661_10150834 3300025944 Bacteria 2009
79 Ga0207667_10192091 3300025949 Bacteria 2095
80 Ga0207702_10200424 3300026078 Bacteria 1849
81 Ga0207676_10026858 3300026095 Bacteria 4283
82 Ga0207676_10213710 3300026095 Bacteria 1713
83 Ga0207676_10526527 3300026095 Bacteria 1126
84 Ga0207683_10002576 3300026121 Bacteria 15829
85 Ga0268266_10004085 3300028379 Bacteria 14103
86 Ga0268265_12435758 3300028380 Bacteria 530
87 Ga0265338_10007540 3300028800 Bacteria 13457
88 Ga0307509_10008128 3300031507 Bacteria 13459
89 Ga0307405_10185640 3300031731 Bacteria 1497
90 Ga0307409_102421374 3300031995 Bacteria 554
91 Ga0307415_100522867 3300032126 Bacteria 1042
92 Ga0373937_0491104 3300036401 Bacteria 1166
93 Ga0395899_0006748 3300037312 Bacteria 8892
94 Ga0395900_0003731 3300037418 Bacteria 16351
95 Ga0395900_0456013 3300037418 Bacteria 1234
96 Ga0395905_0108894 3300037471 Bacteria 2601
97 Ga0395905_0297746 3300037471 Bacteria 1500
98 Ga0395901_0019668 3300038443 Bacteria 6902
99 Ga0400489_32704 3300039093 Bacteria 1445
100 Ga0436365_0911826 3300039437 Unclassified 506
101 Ga0451789_1004175 3300041443 Bacteria 883
102 Ga0451807_0878500 3300041486 Bacteria 673
103 Ga0451807_2704168 3300041486 Bacteria 579
104 Ga0451847_0914266 3300041503 Bacteria 745
105 Ga0451843_1469664 3300041509 Bacteria 715
106 Ga0451853_0096023 3300041512 Bacteria 523
107 Ga0451576_0726700 3300045051 Bacteria 1043
108 Ga0466967_0458297 3300045976 Bacteria 1247
109 Ga0495596_0124752 3300046500 Bacteria 999
110 Ga0496100_0333641 3300048903 Bacteria 1142
111 Ga0496114_0412952 3300048917 Bacteria 1195
112 Ga0496115_0076093 3300048918 Bacteria 2728
113 Ga0501296_028543 3300049519 Bacteria 743
114 Ga0501031_0492473 3300049568 Bacteria 791
115 Ga0501032_0803522 3300049569 Bacteria 594
116 Ga0501034_0196972 3300049571 Bacteria 1974
117 Ga0501036_1105718 3300049572 Bacteria 647
118 Ga0501037_0224142 3300049573 Bacteria 1322
119 Ga0501043_0562726 3300049579 Bacteria 846
120 Ga0501046_0204537 3300049580 Bacteria 1468
121 Ga0501047_0005606 3300049581 Bacteria 11823
122 Ga0501047_0107864 3300049581 Bacteria 2666
123 Ga0501047_0829496 3300049581 Bacteria 739
124 Ga0501048_0127350 3300049582 Bacteria 1801
125 Ga0501070_0021048 3300049586 Bacteria 5472
126 Ga0501070_0039132 3300049586 Bacteria 3956
127 Ga0501070_0266878 3300049586 Bacteria 1398
128 Ga0501070_1000887 3300049586 Bacteria 648
129 Ga0501072_0928211 3300049588 Bacteria 680
130 Ga0501073_0234799 3300049589 Bacteria 1267
131 Ga0501074_0181817 3300049590 Bacteria 1500
132 Ga0501202_197747 3300049652 Bacteria 549
133 Ga0501223_060121 3300049663 Bacteria 742
134 Ga0501227_016199 3300049665 Bacteria 1672
135 Ga0501249_093544 3300049679 Bacteria 715
136 Ga0501234_079174 3300049707 Bacteria 577
137 Ga0501268_143322 3300049765 Bacteria 546
138 Ga0501035_0169832 3300049822 Bacteria 1885
139 Ga0501044_0035288 3300049823 Bacteria 5238
140 Ga0501045_1231469 3300049824 Bacteria 546
141 nmdc:mga09592_100278_c1 3300050508 Bacteria 2480
142 nmdc:mga09592_1302097_c1 3300050508 Bacteria 597
143 nmdc:mga09592_799237_c1 3300050508 Bacteria 798
144 nmdc:mga0qj67_813122_c1 3300050509 Bacteria 739
145 nmdc:mga06r32_130216_c1 3300050510 Bacteria 2487
146 nmdc:mga0n895_234715_c1 3300050512 Bacteria 1861
147 nmdc:mga0rr50_29411_c1 3300050513 Bacteria 3874
148 Ga0500559_0191117 3300053136 Bacteria 965
149 Ga0500568_0018963 3300053139 Bacteria 3001
150 Ga0500568_0069347 3300053139 Bacteria 1352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039093 Ga0400489_32704 Ga0400489_32704_635_901 88
2 3300005329 Ga0070683_100192145 Ga0070683_1001921452 89
3 3300005330 Ga0070690_100965846 Ga0070690_1009658462 89
4 3300005437 Ga0070710_10120971 Ga0070710_101209712 89
5 3300006237 Ga0097621_100354336 Ga0097621_1003543362 89
6 3300006358 Ga0068871_100603072 Ga0068871_1006030722 89
7 3300009098 Ga0105245_11136458 Ga0105245_111364582 89
8 3300025927 Ga0207687_11357232 Ga0207687_113572322 89
9 3300025944 Ga0207661_10150834 Ga0207661_101508342 89
10 3300048903 Ga0496100_0333641 Ga0496100_0333641_670_939 89
11 3300048917 Ga0496114_0412952 Ga0496114_0412952_269_538 89
12 3300005340 Ga0070689_100201688 Ga0070689_1002016882 91
13 3300005458 Ga0070681_10055008 Ga0070681_100550082 91
14 3300005471 Ga0070698_100000632 Ga0070698_10000063231 91
15 3300005471 Ga0070698_101125943 Ga0070698_1011259432 91
16 3300005530 Ga0070679_100012648 Ga0070679_10001264810 91
17 3300005535 Ga0070684_100727226 Ga0070684_1007272262 91
18 3300005617 Ga0068859_100929500 Ga0068859_1009295002 91
19 3300005618 Ga0068864_100026313 Ga0068864_1000263135 91
20 3300006931 Ga0097620_100929438 Ga0097620_1009294382 91
21 3300025912 Ga0207707_10001455 Ga0207707_100014556 91
22 3300025917 Ga0207660_10058536 Ga0207660_100585363 91
23 3300025921 Ga0207652_10050289 Ga0207652_100502895 91
24 3300025936 Ga0207670_10049906 Ga0207670_100499064 91
25 3300026095 Ga0207676_10026858 Ga0207676_100268585 91
26 3300026095 Ga0207676_10213710 Ga0207676_102137103 91
27 3300049581 Ga0501047_0829496 Ga0501047_0829496_106_381 91
28 3300049586 Ga0501070_0021048 Ga0501070_0021048_1670_1945 91
29 3300049822 Ga0501035_0169832 Ga0501035_0169832_451_726 91
30 3300005329 Ga0070683_100148109 Ga0070683_1001481092 92
31 3300005334 Ga0068869_100650396 Ga0068869_1006503962 92
32 3300005336 Ga0070680_100514422 Ga0070680_1005144222 92
33 3300005336 Ga0070680_101259906 Ga0070680_1012599061 92
34 3300005336 Ga0070680_101290452 Ga0070680_1012904521 92
35 3300005337 Ga0070682_100208016 Ga0070682_1002080161 92
36 3300005356 Ga0070674_101006056 Ga0070674_1010060562 92
37 3300005444 Ga0070694_101600409 Ga0070694_1016004092 92
38 3300005456 Ga0070678_100210315 Ga0070678_1002103152 92
39 3300005456 Ga0070678_102345103 Ga0070678_1023451031 92
40 3300005458 Ga0070681_10457194 Ga0070681_104571942 92
41 3300005466 Ga0070685_11292531 Ga0070685_112925311 92
42 3300005467 Ga0070706_100117816 Ga0070706_1001178162 92
43 3300005518 Ga0070699_100221595 Ga0070699_1002215952 92
44 3300005530 Ga0070679_100035928 Ga0070679_1000359287 92
45 3300005530 Ga0070679_100337752 Ga0070679_1003377523 92
46 3300005530 Ga0070679_100422894 Ga0070679_1004228942 92
47 3300005535 Ga0070684_100665227 Ga0070684_1006652271 92
48 3300005535 Ga0070684_100922584 Ga0070684_1009225842 92
49 3300005535 Ga0070684_101114771 Ga0070684_1011147711 92
50 3300005536 Ga0070697_100174616 Ga0070697_1001746162 92
51 3300005536 Ga0070697_101291716 Ga0070697_1012917162 92
52 3300005544 Ga0070686_101967544 Ga0070686_1019675441 92
53 3300005547 Ga0070693_101404490 Ga0070693_1014044902 92
54 3300005548 Ga0070665_100003907 Ga0070665_1000039078 92
55 3300005549 Ga0070704_100809082 Ga0070704_1008090822 92
56 3300005577 Ga0068857_100260135 Ga0068857_1002601352 92
57 3300005614 Ga0068856_100131271 Ga0068856_1001312713 92
58 3300005614 Ga0068856_100533700 Ga0068856_1005337002 92
59 3300006846 Ga0075430_101273315 Ga0075430_1012733151 92
60 3300006847 Ga0075431_100689389 Ga0075431_1006893892 92
61 3300006880 Ga0075429_100037211 Ga0075429_1000372112 92
62 3300006880 Ga0075429_101383595 Ga0075429_1013835952 92
63 3300006880 Ga0075429_101484990 Ga0075429_1014849902 92
64 3300009098 Ga0105245_10000083 Ga0105245_1000008386 92
65 3300009147 Ga0114129_11266082 Ga0114129_112660822 92
66 3300009147 Ga0114129_11444876 Ga0114129_114448762 92
67 3300009174 Ga0105241_10139091 Ga0105241_101390912 92
68 3300009545 Ga0105237_10648280 Ga0105237_106482802 92
69 3300009545 Ga0105237_10943753 Ga0105237_109437532 92
70 3300010375 Ga0105239_10917603 Ga0105239_109176032 92
71 3300013296 Ga0157374_10245492 Ga0157374_102454922 92
72 3300013296 Ga0157374_11462523 Ga0157374_114625232 92
73 3300014969 Ga0157376_11750775 Ga0157376_117507752 92
74 3300025909 Ga0207705_11041282 Ga0207705_110412821 92
75 3300025910 Ga0207684_10072711 Ga0207684_100727112 92
76 3300025912 Ga0207707_10472402 Ga0207707_104724022 92
77 3300025914 Ga0207671_10593882 Ga0207671_105938822 92
78 3300025917 Ga0207660_10106051 Ga0207660_101060512 92
79 3300025921 Ga0207652_10160832 Ga0207652_101608322 92
80 3300025921 Ga0207652_10380941 Ga0207652_103809412 92
81 3300025921 Ga0207652_10803689 Ga0207652_108036892 92
82 3300025927 Ga0207687_10000404 Ga0207687_100004046 92
83 3300025934 Ga0207686_10310462 Ga0207686_103104622 92
84 3300025937 Ga0207669_10556239 Ga0207669_105562392 92
85 3300025941 Ga0207711_11903569 Ga0207711_119035692 92
86 3300025942 Ga0207689_10327187 Ga0207689_103271872 92
87 3300025949 Ga0207667_10192091 Ga0207667_101920913 92
88 3300026078 Ga0207702_10200424 Ga0207702_102004242 92
89 3300026095 Ga0207676_10526527 Ga0207676_105265272 92
90 3300026121 Ga0207683_10002576 Ga0207683_100025768 92
91 3300028379 Ga0268266_10004085 Ga0268266_100040855 92
92 3300028380 Ga0268265_12435758 Ga0268265_124357582 92
93 3300028800 Ga0265338_10007540 Ga0265338_100075406 92
94 3300031507 Ga0307509_10008128 Ga0307509_100081288 92
95 3300031731 Ga0307405_10185640 Ga0307405_101856402 92
96 3300031995 Ga0307409_102421374 Ga0307409_1024213742 92
97 3300032126 Ga0307415_100522867 Ga0307415_1005228671 92
98 3300036401 Ga0373937_0491104 Ga0373937_0491104_42_320 92
99 3300037312 Ga0395899_0006748 Ga0395899_0006748_8206_8484 92
100 3300037418 Ga0395900_0003731 Ga0395900_0003731_4293_4571 92
101 3300037418 Ga0395900_0456013 Ga0395900_0456013_230_508 92
102 3300037471 Ga0395905_0108894 Ga0395905_0108894_137_415 92
103 3300037471 Ga0395905_0297746 Ga0395905_0297746_594_872 92
104 3300038443 Ga0395901_0019668 Ga0395901_0019668_2769_3047 92
105 3300039437 Ga0436365_0911826 Ga0436365_0911826_191_469 92
106 3300041443 Ga0451789_1004175 Ga0451789_1004175_166_444 92
107 3300041486 Ga0451807_0878500 Ga0451807_0878500_292_576 92
108 3300041486 Ga0451807_2704168 Ga0451807_2704168_278_565 92
109 3300041503 Ga0451847_0914266 Ga0451847_0914266_59_343 92
110 3300041509 Ga0451843_1469664 Ga0451843_1469664_394_678 92
111 3300041512 Ga0451853_0096023 Ga0451853_0096023_99_377 92
112 3300045051 Ga0451576_0726700 Ga0451576_0726700_755_1033 92
113 3300045976 Ga0466967_0458297 Ga0466967_0458297_229_507 92
114 3300046500 Ga0495596_0124752 Ga0495596_0124752_336_614 92
115 3300048918 Ga0496115_0076093 Ga0496115_0076093_1869_2147 92
116 3300049519 Ga0501296_028543 Ga0501296_028543_91_369 92
117 3300049568 Ga0501031_0492473 Ga0501031_0492473_331_618 92
118 3300049569 Ga0501032_0803522 Ga0501032_0803522_106_393 92
119 3300049571 Ga0501034_0196972 Ga0501034_0196972_831_1118 92
120 3300049572 Ga0501036_1105718 Ga0501036_1105718_198_485 92
121 3300049573 Ga0501037_0224142 Ga0501037_0224142_818_1105 92
122 3300049579 Ga0501043_0562726 Ga0501043_0562726_524_808 92
123 3300049580 Ga0501046_0204537 Ga0501046_0204537_72_359 92
124 3300049581 Ga0501047_0005606 Ga0501047_0005606_8109_8393 92
125 3300049581 Ga0501047_0107864 Ga0501047_0107864_1302_1589 92
126 3300049582 Ga0501048_0127350 Ga0501048_0127350_39_326 92
127 3300049586 Ga0501070_0039132 Ga0501070_0039132_331_618 92
128 3300049586 Ga0501070_0266878 Ga0501070_0266878_1081_1365 92
129 3300049586 Ga0501070_1000887 Ga0501070_1000887_38_316 92
130 3300049588 Ga0501072_0928211 Ga0501072_0928211_204_482 92
131 3300049589 Ga0501073_0234799 Ga0501073_0234799_646_933 92
132 3300049590 Ga0501074_0181817 Ga0501074_0181817_519_806 92
133 3300049652 Ga0501202_197747 Ga0501202_197747_83_361 92
134 3300049663 Ga0501223_060121 Ga0501223_060121_425_703 92
135 3300049665 Ga0501227_016199 Ga0501227_016199_1294_1572 92
136 3300049679 Ga0501249_093544 Ga0501249_093544_303_581 92
137 3300049707 Ga0501234_079174 Ga0501234_079174_17_295 92
138 3300049765 Ga0501268_143322 Ga0501268_143322_134_412 92
139 3300049823 Ga0501044_0035288 Ga0501044_0035288_2915_3199 92
140 3300049824 Ga0501045_1231469 Ga0501045_1231469_214_498 92
141 3300050508 nmdc:mga09592_100278_c1 nmdc:mga09592_100278_c1_463_744 92
142 3300050508 nmdc:mga09592_1302097_c1 nmdc:mga09592_1302097_c1_211_504 92
143 3300050508 nmdc:mga09592_799237_c1 nmdc:mga09592_799237_c1_290_571 92
144 3300050509 nmdc:mga0qj67_813122_c1 nmdc:mga0qj67_813122_c1_265_543 92
145 3300050510 nmdc:mga06r32_130216_c1 nmdc:mga06r32_130216_c1_175_465 92
146 3300050512 nmdc:mga0n895_234715_c1 nmdc:mga0n895_234715_c1_1457_1747 92
147 3300050513 nmdc:mga0rr50_29411_c1 nmdc:mga0rr50_29411_c1_3540_3830 92
148 3300053136 Ga0500559_0191117 Ga0500559_0191117_534_812 92
149 3300053139 Ga0500568_0018963 Ga0500568_0018963_728_1051 92
150 3300053139 Ga0500568_0069347 Ga0500568_0069347_1021_1305 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

5

87

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1opd-assembly1.cif.gz_A histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) 0.9855 5 84
1cm3-assembly1.cif.gz_A his15asp hpr from e. coli 0.9836 5 84
4xwj-assembly1.cif.gz_B histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex 0.9825 5 85
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9823 5 86
1cm2-assembly1.cif.gz_A structure of his15asp hpr after hydrolysis of ringed species. 0.98 5 84
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9755 5 86 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9681 5 90 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9657 7 85 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9513 3 84 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9467 5 90 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A800AHE6-F1-model_v4 HPr family phosphocarrier protein 1 5 90 GO:0005737
GO:0009401
AF-A0A1W9VSB2-F1-model_v4 Phosphocarrier protein HPr 0.9981 5 90 GO:0005737
GO:0009401
AF-A0A2D5UEY2-F1-model_v4 Phosphocarrier protein HPr 0.9977 5 90 GO:0005737
GO:0009401
AF-A0A7J5EXF8-F1-model_v4 HPr family phosphocarrier protein 0.9973 2 92 GO:0005737
GO:0009401
AF-A0A518BW11-F1-model_v4 HPr-like protein Crh 0.9969 2 90 GO:0005737
GO:0009401

Feature Viewer

pLDDT pTM Quality
96.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map