F207672

General Info

Members Datasets Scaffolds Average Seq Length
150 113 146 428

Family's Representative Sequence

Representative Sequence 3300003763|Ga0055529_1001082|Ga0055529_10010822
Length 485
Sequence MLYSHSVATKQYKQLHLLTYSKKKRYLPIICNRLQLAYTTHWETRKNMNSTLLRGVLVGGLAGLLFGFDTAVIAGTTQGLSAAFHLDPAALGWTVSSALWGTLIGALVAGLPGDAFGARNCLRVIALMYVASGIGSFCATSLPVLIAARVLGGLAIGASSVLAPTYLAEIAPARMRGALVGMFQLNIVFGILVAYLSNYLIGTLDLGDAEWRWKFGVTILPSLILWLLLYTIPNSPRWLAVKDRLDEARKVLRQIGVPQPDTELALYQRQHLEHKGVKVRLSWKAYARPMLLAIAIAGFNQLSGINAILYYLNDIFAAAGFAKVSADLQSVIIGATNLAFTLLALTVIDRAGRKTLLLIGSVGLVISLAGTAFIQLTSTHQNYLLWMLILFIASFAFSQGAVIWVYIAEIFPTEVRSRGQGLGASTHWFMDAVIATAFPLVAAYSKGLPFVFFAAAMAVQFLVVLKFFPETKGATLEEIHLGGKA

Samples

Sample ID Description Type Environment
1 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
2 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
3 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
34 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
73 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
74 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
109 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0.67
Isolates 2.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0
Rhizoplane 3.33
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 14.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10003085 3300002067 Bacteria 5704
2 rootH2_10003244 3300003320 Bacteria 3966
3 rootH2_10012842 3300003320 Bacteria 4615
4 rootH2_10013843 3300003320 Bacteria 5404
5 rootH2_10069138 3300003320 Bacteria 7675
6 rootL2_10093470 3300003322 Bacteria 9372
7 rootH1_10001020 3300003323 Bacteria 28506
8 rootH1_10007718 3300003323 Bacteria 5310
9 rootH1_10104213 3300003323 Bacteria 2913
10 rootH1_10214340 3300003323 Bacteria 2229
11 Ga0055529_1001082 3300003763 Bacteria 12469
12 Ga0070658_10000221 3300005327 Bacteria 50678
13 Ga0070677_10036441 3300005333 Bacteria 1913
14 Ga0070660_100000337 3300005339 Bacteria 31136
15 Ga0070660_100013707 3300005339 Bacteria 5827
16 Ga0070659_100039219 3300005366 Bacteria 3697
17 Ga0070709_10062056 3300005434 Unclassified 2382
18 Ga0070701_10024836 3300005438 Bacteria 2903
19 Ga0070711_100111085 3300005439 Bacteria 2012
20 Ga0070711_100149552 3300005439 Bacteria 1759
21 Ga0070678_100059859 3300005456 Bacteria 2800
22 Ga0070679_100012120 3300005530 Bacteria 8236
23 Ga0070693_100077882 3300005547 Bacteria 1969
24 Ga0070665_100027825 3300005548 Bacteria 5693
25 Ga0068855_100007300 3300005563 Bacteria 13385
26 Ga0068855_100234722 3300005563 Unclassified 2052
27 Ga0068856_100000208 3300005614 Bacteria 63132
28 Ga0068861_100009783 3300005719 Bacteria 6629
29 Ga0081455_10003315 3300005937 Bacteria 18615
30 Ga0070716_100000271 3300006173 Bacteria 20855
31 Ga0075370_10019515 3300006353 Bacteria 3694
32 Ga0105240_10060171 3300009093 Bacteria 4736
33 Ga0105237_10118464 3300009545 Bacteria 2642
34 Ga0105239_10018672 3300010375 Bacteria 7659
35 Ga0157370_10002005 3300013104 Bacteria 25033
36 Ga0157369_10005920 3300013105 Bacteria 14200
37 Ga0157369_10058397 3300013105 Bacteria 4162
38 Ga0157374_10001785 3300013296 Bacteria 18097
39 Ga0157375_10094152 3300013308 Unclassified 3063
40 Ga0183365_10008 3300015684 Bacteria 74681
41 Ga0209437_103912 3300025233 Bacteria 2649
42 Ga0209026_1002114 3300025250 Bacteria 7781
43 Ga0209455_1000044 3300025272 Bacteria 410787
44 Ga0207705_10000100 3300025909 Bacteria 102196
45 Ga0207705_10104886 3300025909 Bacteria 2083
46 Ga0207695_10051542 3300025913 Bacteria 4320
47 Ga0207662_10011419 3300025918 Bacteria 4926
48 Ga0207657_10000642 3300025919 Bacteria 37108
49 Ga0207657_10002186 3300025919 Bacteria 21186
50 Ga0207649_10035936 3300025920 Bacteria 2981
51 Ga0207652_10036430 3300025921 Bacteria 4159
52 Ga0207665_10000015 3300025939 Bacteria 133147
53 Ga0207691_10009377 3300025940 Bacteria 9398
54 Ga0207691_10025083 3300025940 Bacteria 5600
55 Ga0207679_10118998 3300025945 Bacteria 2099
56 Ga0207678_10025426 3300026067 Bacteria 5168
57 Ga0207678_10198420 3300026067 Bacteria 1715
58 Ga0207702_10053302 3300026078 Bacteria 3424
59 Ga0207675_100005368 3300026118 Bacteria 12299
60 Ga0207683_10018066 3300026121 Bacteria 6014
61 Ga0209970_1005101 3300027614 Bacteria 2170
62 Ga0265354_1000849 3300028016 Bacteria 4920
63 Ga0268266_10015486 3300028379 Bacteria 6543
64 Ga0307515_10001513 3300028794 Bacteria 52028
65 Ga0307515_10026085 3300028794 Bacteria 10075
66 Ga0307515_10168678 3300028794 Unclassified 2194
67 Ga0265760_10006467 3300031090 Bacteria 3350
68 Ga0307513_10211156 3300031456 Bacteria 1772
69 Ga0307408_100022966 3300031548 Bacteria 4245
70 Ga0307405_10053642 3300031731 Bacteria 2513
71 Ga0307413_10032825 3300031824 Bacteria 2947
72 Ga0307410_10008761 3300031852 Bacteria 5632
73 Ga0307410_10151187 3300031852 Unclassified 1729
74 Ga0307406_10009193 3300031901 Bacteria 5536
75 Ga0307407_10019795 3300031903 Bacteria 3434
76 Ga0307407_10055703 3300031903 Bacteria 2286
77 Ga0307412_10002323 3300031911 Bacteria 10524
78 Ga0307409_100001729 3300031995 Bacteria 11012
79 Ga0307409_100050998 3300031995 Bacteria 3164
80 Ga0307416_100039859 3300032002 Bacteria 3642
81 Ga0307416_100115161 3300032002 Bacteria 2380
82 Ga0307411_10024707 3300032005 Bacteria 3586
83 Ga0307510_10031625 3300033180 Bacteria 5975
84 Ga0395899_0000456 3300037312 Bacteria 46281
85 Ga0395899_0000669 3300037312 Bacteria 34717
86 Ga0395899_0004531 3300037312 Bacteria 10827
87 Ga0395899_0011914 3300037312 Bacteria 6660
88 Ga0395900_0001777 3300037418 Bacteria 24746
89 Ga0395900_0002797 3300037418 Bacteria 19062
90 Ga0395900_0014853 3300037418 Bacteria 7936
91 Ga0395900_0175523 3300037418 Bacteria 2179
92 Ga0395898_0000315 3300037466 Bacteria 111811
93 Ga0395898_0010753 3300037466 Bacteria 9559
94 Ga0395905_0000005 3300037471 Bacteria 557808
95 Ga0395905_0008715 3300037471 Bacteria 9982
96 Ga0395905_0192487 3300037471 Unclassified 1913
97 Ga0395901_0006179 3300038443 Bacteria 12137
98 Ga0395901_0212636 3300038443 Bacteria 2023
99 Ga0451791_1927725 3300041451 Bacteria 3985
100 Ga0451797_0123059 3300041453 Bacteria 1842
101 Ga0451807_0340413 3300041486 Bacteria 2755
102 Ga0466969_0000231 3300044656 Bacteria 30436
103 Ga0466966_0000982 3300044684 Bacteria 18280
104 Ga0466961_0012243 3300044693 Bacteria 5485
105 Ga0466971_0003423 3300044719 Bacteria 6783
106 Ga0466970_0002588 3300044765 Bacteria 8717
107 Ga0466957_0038414 3300044842 Bacteria 2884
108 Ga0466959_0012413 3300045049 Bacteria 6155
109 Ga0466958_0009098 3300045836 Bacteria 5520
110 Ga0495638_0007577 3300046460 Bacteria 7766
111 Ga0495606_0010626 3300046507 Bacteria 7618
112 Ga0495610_0001973 3300046512 Bacteria 17567
113 Ga0495610_0004465 3300046512 Bacteria 10332
114 Ga0495637_0009476 3300046520 Bacteria 4748
115 Ga0495648_0013279 3300046524 Bacteria 6100
116 Ga0495633_0011421 3300046558 Bacteria 4790
117 Ga0495649_0012684 3300046694 Bacteria 4889
118 Ga0495681_0000047 3300047470 Bacteria 110934
119 Ga0495686_0000944 3300047472 Bacteria 36054
120 Ga0495686_0005003 3300047472 Bacteria 10645
121 Ga0495686_0005024 3300047472 Bacteria 10621
122 Ga0495686_0070673 3300047472 Bacteria 2150
123 Ga0495626_0000681 3300048091 Bacteria 32537
124 Ga0496112_0010566 3300048915 Bacteria 8384
125 Ga0496113_0009689 3300048916 Bacteria 6327
126 Ga0496120_0031795 3300048923 Bacteria 3190
127 Ga0496121_0008291 3300048924 Bacteria 12289
128 Ga0496124_0001405 3300048927 Bacteria 35949
129 Ga0496124_0002692 3300048927 Bacteria 22733
130 Ga0496126_0009727 3300048929 Bacteria 10187
131 Ga0495678_023170 3300049459 Bacteria 2705
132 Ga0501034_0346552 3300049571 Bacteria 1415
133 Ga0501040_0012729 3300049576 Bacteria 5520
134 Ga0501041_0020632 3300049577 Bacteria 3941
135 Ga0501046_0074541 3300049580 Bacteria 2633
136 Ga0501075_0052851 3300049591 Bacteria 3055
137 Ga0501080_0049481 3300049742 Bacteria 3912
138 Ga0501080_0183110 3300049742 Bacteria 1927
139 Ga0501035_0019929 3300049822 Bacteria 6161
140 Ga0501035_0086723 3300049822 Bacteria 2758
141 nmdc:mga07m45_31795_c1 3300050496 Bacteria 2924
142 Ga0500635_0000760 3300053080 Bacteria 8033
143 Ga0500608_000718 3300053122 Bacteria 12157
144 Ga0500622_0039644 3300053156 Bacteria 2455
145 Ga0500624_000021 3300053157 Bacteria 117511
146 Ga0466962_0000395 3300061719 Bacteria 18868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10026085 Ga0307515_100260855 363
2 3300033180 Ga0307510_10031625 Ga0307510_100316254 368
3 3300053156 Ga0500622_0039644 Ga0500622_0039644_332_1684 370
4 3300003323 rootH1_10007718 rootH1_100077187 372
5 3300003320 rootH2_10003244 rootH2_100032441 379
6 3300046524 Ga0495648_0013279 Ga0495648_0013279_193_1497 383
7 3300044656 Ga0466969_0000231 Ga0466969_0000231_17054_18352 386
8 3300044684 Ga0466966_0000982 Ga0466966_0000982_7832_9130 386
9 3300044693 Ga0466961_0012243 Ga0466961_0012243_3546_4844 386
10 3300044719 Ga0466971_0003423 Ga0466971_0003423_4325_5623 386
11 3300044842 Ga0466957_0038414 Ga0466957_0038414_525_1823 386
12 3300045049 Ga0466959_0012413 Ga0466959_0012413_1387_2685 386
13 3300045836 Ga0466958_0009098 Ga0466958_0009098_1054_2352 386
14 3300061719 Ga0466962_0000395 Ga0466962_0000395_1208_2506 386
15 3300049576 Ga0501040_0012729 Ga0501040_0012729_2279_3607 388
16 3300005614 Ga0068856_100000208 Ga0068856_10000020851 390
17 3300013105 Ga0157369_10005920 Ga0157369_100059204 390
18 3300013296 Ga0157374_10001785 Ga0157374_100017854 390
19 3300025250 Ga0209026_1002114 Ga0209026_10021145 390
20 3300026078 Ga0207702_10053302 Ga0207702_100533022 390
21 3300037312 Ga0395899_0000456 Ga0395899_0000456_22814_24112 390
22 3300037418 Ga0395900_0014853 Ga0395900_0014853_4261_5559 390
23 3300025940 Ga0207691_10025083 Ga0207691_100250833 394
24 3300041453 Ga0451797_0123059 Ga0451797_0123059_56_1402 394
25 3300026067 Ga0207678_10198420 Ga0207678_101984201 395
26 3300037418 Ga0395900_0002797 Ga0395900_0002797_2675_3973 395
27 3300041451 Ga0451791_1927725 Ga0451791_1927725_1067_2413 395
28 3300049577 Ga0501041_0020632 Ga0501041_0020632_2057_3388 396
29 3300049580 Ga0501046_0074541 Ga0501046_0074541_825_2159 397
30 3300025945 Ga0207679_10118998 Ga0207679_101189982 398
31 iso_pu_bacteria 2919138771 2919140608 398
32 3300005333 Ga0070677_10036441 Ga0070677_100364412 399
33 3300005339 Ga0070660_100000337 Ga0070660_10000033718 399
34 3300009545 Ga0105237_10118464 Ga0105237_101184642 399
35 3300010375 Ga0105239_10018672 Ga0105239_100186722 399
36 3300013105 Ga0157369_10058397 Ga0157369_100583972 399
37 3300025919 Ga0207657_10000642 Ga0207657_1000064227 399
38 3300025918 Ga0207662_10011419 Ga0207662_100114193 400
39 3300006173 Ga0070716_100000271 Ga0070716_10000027112 401
40 3300025939 Ga0207665_10000015 Ga0207665_1000001533 401
41 3300005438 Ga0070701_10024836 Ga0070701_100248362 403
42 3300047472 Ga0495686_0005003 Ga0495686_0005003_9244_10587 403
43 3300005439 Ga0070711_100149552 Ga0070711_1001495521 404
44 3300044765 Ga0466970_0002588 Ga0466970_0002588_687_1985 404
45 3300005548 Ga0070665_100027825 Ga0070665_1000278253 405
46 3300028379 Ga0268266_10015486 Ga0268266_100154863 405
47 3300031911 Ga0307412_10002323 Ga0307412_100023237 405
48 3300048923 Ga0496120_0031795 Ga0496120_0031795_1171_2481 405
49 3300048927 Ga0496124_0002692 Ga0496124_0002692_6264_7574 405
50 iso_pu_bacteria 2818991438 2819555450 407
51 iso_pu_bacteria 8054302542 8054304626 407
52 3300005327 Ga0070658_10000221 Ga0070658_100002212 409
53 3300005563 Ga0068855_100007300 Ga0068855_1000073009 409
54 3300025909 Ga0207705_10000100 Ga0207705_100001002 409
55 3300028794 Ga0307515_10001513 Ga0307515_1000151321 409
56 3300005456 Ga0070678_100059859 Ga0070678_1000598593 410
57 3300025940 Ga0207691_10009377 Ga0207691_100093772 410
58 3300026121 Ga0207683_10018066 Ga0207683_100180662 410
59 3300049571 Ga0501034_0346552 Ga0501034_0346552_81_1376 410
60 3300053080 Ga0500635_0000760 Ga0500635_0000760_1082_2377 410
61 3300053122 Ga0500608_000718 Ga0500608_000718_2009_3304 410
62 iso_pu_bacteria 2884215851 2884217152 410
63 3300003323 rootH1_10214340 rootH1_102143402 411
64 3300006353 Ga0075370_10019515 Ga0075370_100195152 411
65 3300028794 Ga0307515_10168678 Ga0307515_101686782 411
66 3300046507 Ga0495606_0010626 Ga0495606_0010626_5393_6697 411
67 3300046512 Ga0495610_0001973 Ga0495610_0001973_1281_2585 411
68 3300046512 Ga0495610_0004465 Ga0495610_0004465_5576_6880 411
69 3300046520 Ga0495637_0009476 Ga0495637_0009476_1716_3020 411
70 3300046558 Ga0495633_0011421 Ga0495633_0011421_999_2315 411
71 3300047470 Ga0495681_0000047 Ga0495681_0000047_6151_7455 411
72 3300047472 Ga0495686_0000944 Ga0495686_0000944_8805_10109 411
73 3300047472 Ga0495686_0005024 Ga0495686_0005024_6947_8251 411
74 3300047472 Ga0495686_0070673 Ga0495686_0070673_715_2019 411
75 3300048091 Ga0495626_0000681 Ga0495626_0000681_24396_25700 411
76 3300048924 Ga0496121_0008291 Ga0496121_0008291_5500_6807 411
77 3300048927 Ga0496124_0001405 Ga0496124_0001405_28200_29507 411
78 3300049459 Ga0495678_023170 Ga0495678_023170_510_1814 411
79 3300050496 nmdc:mga07m45_31795_c1 nmdc:mga07m45_31795_c1_1599_2903 411
80 3300053157 Ga0500624_000021 Ga0500624_000021_30999_32315 411
81 3300049822 Ga0501035_0019929 Ga0501035_0019929_1219_2520 412
82 3300003320 rootH2_10012842 rootH2_100128422 413
83 3300003322 rootL2_10093470 rootL2_100934707 413
84 3300003323 rootH1_10001020 rootH1_100010206 413
85 3300003323 rootH1_10104213 rootH1_101042132 413
86 3300003763 Ga0055529_1001082 Ga0055529_10010822 413
87 3300015684 Ga0183365_10008 Ga0183365_100088 413
88 3300025233 Ga0209437_103912 Ga0209437_1039122 413
89 3300025272 Ga0209455_1000044 Ga0209455_10000442 413
90 3300037312 Ga0395899_0011914 Ga0395899_0011914_974_2284 413
91 3300003320 rootH2_10013843 rootH2_100138433 414
92 3300003320 rootH2_10069138 rootH2_100691386 414
93 3300005434 Ga0070709_10062056 Ga0070709_100620562 414
94 3300005547 Ga0070693_100077882 Ga0070693_1000778821 414
95 3300009093 Ga0105240_10060171 Ga0105240_100601712 414
96 3300028016 Ga0265354_1000849 Ga0265354_10008492 414
97 3300031090 Ga0265760_10006467 Ga0265760_100064672 414
98 3300048929 Ga0496126_0009727 Ga0496126_0009727_4995_6365 414
99 3300049822 Ga0501035_0086723 Ga0501035_0086723_1044_2366 414
100 3300025909 Ga0207705_10104886 Ga0207705_101048862 415
101 3300046694 Ga0495649_0012684 Ga0495649_0012684_2505_3872 415
102 3300049591 Ga0501075_0052851 Ga0501075_0052851_654_1997 415
103 3300049742 Ga0501080_0049481 Ga0501080_0049481_1951_3294 415
104 3300005563 Ga0068855_100234722 Ga0068855_1002347222 416
105 3300005937 Ga0081455_10003315 Ga0081455_1000331513 416
106 3300013104 Ga0157370_10002005 Ga0157370_1000200510 416
107 3300027614 Ga0209970_1005101 Ga0209970_10051012 416
108 3300013308 Ga0157375_10094152 Ga0157375_100941522 417
109 3300031548 Ga0307408_100022966 Ga0307408_1000229663 417
110 3300031731 Ga0307405_10053642 Ga0307405_100536422 417
111 3300031901 Ga0307406_10009193 Ga0307406_100091933 417
112 3300031903 Ga0307407_10055703 Ga0307407_100557032 417
113 3300031995 Ga0307409_100050998 Ga0307409_1000509981 417
114 3300032002 Ga0307416_100039859 Ga0307416_1000398592 417
115 3300037471 Ga0395905_0192487 Ga0395905_0192487_550_1860 417
116 3300048915 Ga0496112_0010566 Ga0496112_0010566_832_2142 417
117 3300048916 Ga0496113_0009689 Ga0496113_0009689_4780_6090 417
118 3300049742 Ga0501080_0183110 Ga0501080_0183110_439_1803 417
119 3300002067 JGI24735J21928_10003085 JGI24735J21928_100030855 418
120 3300005339 Ga0070660_100013707 Ga0070660_1000137075 418
121 3300005366 Ga0070659_100039219 Ga0070659_1000392192 418
122 3300005439 Ga0070711_100111085 Ga0070711_1001110851 418
123 3300005530 Ga0070679_100012120 Ga0070679_1000121204 418
124 3300005719 Ga0068861_100009783 Ga0068861_1000097835 418
125 3300025913 Ga0207695_10051542 Ga0207695_100515424 418
126 3300025919 Ga0207657_10002186 Ga0207657_100021864 418
127 3300025920 Ga0207649_10035936 Ga0207649_100359362 418
128 3300025921 Ga0207652_10036430 Ga0207652_100364301 418
129 3300026067 Ga0207678_10025426 Ga0207678_100254263 418
130 3300026118 Ga0207675_100005368 Ga0207675_10000536810 418
131 3300031456 Ga0307513_10211156 Ga0307513_102111562 418
132 3300031824 Ga0307413_10032825 Ga0307413_100328253 418
133 3300031852 Ga0307410_10008761 Ga0307410_100087614 418
134 3300031852 Ga0307410_10151187 Ga0307410_101511872 418
135 3300031903 Ga0307407_10019795 Ga0307407_100197954 418
136 3300031995 Ga0307409_100001729 Ga0307409_1000017297 418
137 3300032002 Ga0307416_100115161 Ga0307416_1001151613 418
138 3300032005 Ga0307411_10024707 Ga0307411_100247074 418
139 3300037312 Ga0395899_0000669 Ga0395899_0000669_29779_31089 418
140 3300037312 Ga0395899_0004531 Ga0395899_0004531_2391_3701 418
141 3300037418 Ga0395900_0001777 Ga0395900_0001777_6463_7773 418
142 3300037418 Ga0395900_0175523 Ga0395900_0175523_186_1496 418
143 3300037466 Ga0395898_0000315 Ga0395898_0000315_94843_96153 418
144 3300037466 Ga0395898_0010753 Ga0395898_0010753_6499_7809 418
145 3300037471 Ga0395905_0000005 Ga0395905_0000005_455617_456927 418
146 3300037471 Ga0395905_0008715 Ga0395905_0008715_6622_7932 418
147 3300038443 Ga0395901_0006179 Ga0395901_0006179_8992_10302 418
148 3300038443 Ga0395901_0212636 Ga0395901_0212636_84_1442 418
149 3300041486 Ga0451807_0340413 Ga0451807_0340413_522_1862 418
150 3300046460 Ga0495638_0007577 Ga0495638_0007577_2318_3694 418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

56

482

0.94

PF07690

MFS_1

Major Facilitator Superfamily

59

435

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.9047 1 409
6n3i-assembly1.cif.gz_A crystal structure of a double trp xyle mutants (g58w/l315w) 0.9004 1 410
7spt-assembly1.cif.gz_A crystal structure of exofacial state human glucose transporter glut3 0.8896 3 415
7sps-assembly2.cif.gz_B crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 0.8883 3 413
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.886 1 409
ID Description Score Start End Superfamily
af_A0A1D6LG74_1_148_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9453 51 198 1.20.1250.20
af_Q54UC8_60_259_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9427 8 199 1.20.1250.20
4ja3A01 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9411 8 185 1.20.1250.20
4gc0A01 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.94 7 207 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9355 3 195 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7J7IA87-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.932 8 217 GO:0015144
GO:0015293
GO:0016020
AF-A0A835FNJ7-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9303 2 217 GO:0015144
GO:0015293
GO:0016020
AF-A0A7S4J2G5-F1-model_v4 Hexose transporter 1 0.9302 3 214 GO:0005366
GO:0016324
AF-A0A5P1FD29-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9298 7 216 GO:0015144
GO:0015293
GO:0016020
AF-A0A7J8WL38-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9298 1 216 GO:0015144
GO:0015293
GO:0016020

Feature Viewer

pLDDT pTM Quality
83.48 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map