F207614

General Info

Members Datasets Scaffolds Average Seq Length
150 100 300 159

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10000023|JGI25406J46586_1000002329
Length 164
Sequence MPLAVGTKAPDFSLPTKTADGPKQVKLSDNFGKKNTVLLFFPMAFTGVCTTEMCGQSNELASYDKLNAVVYGISGDNPFAQEAWAQKEKIGVTLLSDYEHKVARDYGVAYDSFLPQINLGMAGVAKRSAFVIDKNGVIQYAESSDDAKQLPNFDKIKAKLAELK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 6
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 98
Stem 0
Stem Tuber 0
Unclassified 23.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000023 3300003203 Bacteria 76640
2 rootH2_10035970 3300003320 Bacteria 15517
3 Ga0065715_10456584 3300005293 Unclassified 820
4 Ga0070658_10004141 3300005327 Bacteria 11877
5 Ga0070658_10177328 3300005327 Bacteria 1792
6 Ga0070683_100804019 3300005329 Bacteria 901
7 Ga0070690_100782805 3300005330 Unclassified 739
8 Ga0070660_100535806 3300005339 Unclassified 976
9 Ga0070689_100368908 3300005340 Bacteria 1208
10 Ga0070689_101303509 3300005340 Unclassified 654
11 Ga0070688_101046523 3300005365 Unclassified 650
12 Ga0070709_11146300 3300005434 Unclassified 623
13 Ga0070714_100606816 3300005435 Bacteria 1051
14 Ga0070713_100260330 3300005436 Bacteria 1585
15 Ga0070710_10318471 3300005437 Bacteria 1020
16 Ga0070710_10436918 3300005437 Unclassified 884
17 Ga0070711_100001234 3300005439 Bacteria 13821
18 Ga0070711_100049776 3300005439 Bacteria 2870
19 Ga0070711_100533072 3300005439 Bacteria 972
20 Ga0070694_100030238 3300005444 Bacteria 3541
21 Ga0070708_100088524 3300005445 Bacteria 2815
22 Ga0070708_100471432 3300005445 Bacteria 1184
23 Ga0070708_101248022 3300005445 Unclassified 695
24 Ga0070706_100027802 3300005467 Bacteria 5202
25 Ga0070706_100052304 3300005467 Bacteria 3770
26 Ga0070706_100810170 3300005467 Bacteria 867
27 Ga0070707_100000846 3300005468 Bacteria 30361
28 Ga0070707_100026640 3300005468 Bacteria 5491
29 Ga0070707_100140239 3300005468 Bacteria 2353
30 Ga0070707_100612290 3300005468 Bacteria 1051
31 Ga0070707_100618391 3300005468 Bacteria 1046
32 Ga0070707_100865841 3300005468 Bacteria 868
33 Ga0070698_100021766 3300005471 Bacteria 6714
34 Ga0070698_100049114 3300005471 Bacteria 4309
35 Ga0070699_100283757 3300005518 Bacteria 1483
36 Ga0070699_100714251 3300005518 Unclassified 916
37 Ga0070699_101394994 3300005518 Bacteria 643
38 Ga0070679_100157251 3300005530 Unclassified 2247
39 Ga0070679_100317348 3300005530 Unclassified 1508
40 Ga0070679_100925009 3300005530 Unclassified 816
41 Ga0070679_101561915 3300005530 Unclassified 607
42 Ga0070697_100792013 3300005536 Unclassified 839
43 Ga0070697_101411167 3300005536 Bacteria 622
44 Ga0070686_100000946 3300005544 Bacteria 16730
45 Ga0070695_100791656 3300005545 Unclassified 759
46 Ga0070693_100204889 3300005547 Bacteria 1283
47 Ga0068858_100276572 3300005842 Bacteria 1598
48 Ga0068860_100514741 3300005843 Bacteria 1196
49 Ga0068862_101521294 3300005844 Bacteria 675
50 Ga0081539_10000014 3300005985 Bacteria 411270
51 Ga0081539_10022679 3300005985 Bacteria 4141
52 Ga0070717_10001871 3300006028 Bacteria 14715
53 Ga0070717_10604710 3300006028 Unclassified 995
54 Ga0070716_100282550 3300006173 Bacteria 1146
55 Ga0070712_100343813 3300006175 Bacteria 1219
56 Ga0075431_100894800 3300006847 Bacteria 857
57 Ga0075436_100193531 3300006914 Bacteria 1439
58 Ga0075436_101002204 3300006914 Unclassified 627
59 Ga0075435_100004588 3300007076 Bacteria 9511
60 Ga0075435_100468544 3300007076 Bacteria 1087
61 Ga0105240_10620025 3300009093 Bacteria 1189
62 Ga0111539_10888453 3300009094 Bacteria 1036
63 Ga0105243_10004235 3300009148 Bacteria 11368
64 Ga0105237_10035955 3300009545 Bacteria 5010
65 Ga0105237_10356380 3300009545 Bacteria 1467
66 Ga0105239_11178392 3300010375 Unclassified 883
67 Ga0105246_11148749 3300011119 Unclassified 712
68 Ga0157369_10442105 3300013105 Bacteria 1347
69 Ga0157374_11136305 3300013296 Bacteria 802
70 Ga0157372_10277768 3300013307 Bacteria 1947
71 Ga0157375_12456241 3300013308 Bacteria 622
72 Ga0206349_1369860 3300020075 Unclassified 581
73 Ga0206353_11998563 3300020082 Bacteria 553
74 Ga0224712_10379587 3300022467 Unclassified 671
75 Ga0207692_10320996 3300025898 Bacteria 948
76 Ga0207692_10359051 3300025898 Unclassified 900
77 Ga0207705_10087407 3300025909 Unclassified 2279
78 Ga0207684_10011334 3300025910 Bacteria 7803
79 Ga0207684_10044335 3300025910 Bacteria 3771
80 Ga0207684_10097402 3300025910 Bacteria 2511
81 Ga0207684_10231219 3300025910 Bacteria 1595
82 Ga0207707_10178311 3300025912 Unclassified 1855
83 Ga0207671_10032757 3300025914 Bacteria 3866
84 Ga0207671_10139047 3300025914 Bacteria 1870
85 Ga0207693_10837665 3300025915 Bacteria 708
86 Ga0207663_10051606 3300025916 Bacteria 2562
87 Ga0207663_10504166 3300025916 Bacteria 940
88 Ga0207652_11585769 3300025921 Unclassified 559
89 Ga0207646_10000386 3300025922 Bacteria 59216
90 Ga0207646_10000411 3300025922 Bacteria 57429
91 Ga0207646_10042168 3300025922 Bacteria 4101
92 Ga0207709_10002581 3300025935 Bacteria 11279
93 Ga0207665_10170335 3300025939 Bacteria 1572
94 Ga0207661_10843297 3300025944 Bacteria 844
95 Ga0207703_10062119 3300026035 Unclassified 3060
96 Ga0207641_10756207 3300026088 Bacteria 960
97 Ga0207676_10968307 3300026095 Bacteria 837
98 Ga0268264_10624700 3300028381 Bacteria 1064
99 Ga0265337_1000183 3300028556 Bacteria 33003
100 Ga0265326_10142153 3300028558 Unclassified 685
101 Ga0265319_1000016 3300028563 Bacteria 176245
102 Ga0265318_10110169 3300028577 Unclassified 1012
103 Ga0265336_10016060 3300028666 Bacteria 2451
104 Ga0265338_10001031 3300028800 Bacteria 46585
105 Ga0265338_10001186 3300028800 Bacteria 43013
106 Ga0265338_10061282 3300028800 Bacteria 3298
107 Ga0265338_10108920 3300028800 Bacteria 2236
108 Ga0265338_10279034 3300028800 Bacteria 1221
109 Ga0265338_10295491 3300028800 Unclassified 1179
110 Ga0265320_10005101 3300031240 Bacteria 8483
111 Ga0265320_10132634 3300031240 Unclassified 1131
112 Ga0265340_10014264 3300031247 Bacteria 4155
113 Ga0265327_10059420 3300031251 Bacteria 1958
114 Ga0265316_10014882 3300031344 Bacteria 6824
115 Ga0265316_10049575 3300031344 Bacteria 3307
116 Ga0265316_10395360 3300031344 Bacteria 996
117 Ga0265313_10003086 3300031595 Bacteria 13812
118 Ga0373936_0350672 3300035113 Unclassified 672
119 Ga0373936_0377159 3300035113 Bacteria 649
120 Ga0373943_0042688 3300035170 Bacteria 2199
121 Ga0316574_0710498 3300035398 Unclassified 616
122 Ga0373937_1712212 3300036401 Bacteria 575
123 Ga0451800_0342998 3300041459 Bacteria 669
124 Ga0451577_0033809 3300042876 Bacteria 4610
125 Ga0451577_0162465 3300042876 Bacteria 2011
126 Ga0453684_0212462 3300044712 Bacteria 2248
127 Ga0451576_0577147 3300045051 Unclassified 1182
128 Ga0451576_1436318 3300045051 Bacteria 717
129 Ga0495608_0186104 3300046511 Bacteria 1313
130 Ga0495586_0185856 3300046535 Bacteria 1176
131 Ga0495645_0132853 3300046543 Bacteria 1743
132 Ga0495634_0103197 3300046642 Bacteria 1840
133 Ga0495599_0486718 3300046678 Bacteria 727
134 Ga0495658_0794198 3300046683 Bacteria 606
135 Ga0495680_0162123 3300047322 Bacteria 1623
136 Ga0495675_0229365 3300047444 Bacteria 1121
137 Ga0501305_010333 3300049161 Bacteria 1244
138 Ga0501305_059459 3300049161 Bacteria 655
139 Ga0501305_081099 3300049161 Bacteria 583
140 Ga0501307_028262 3300049162 Unclassified 766
141 Ga0501312_060063 3300049528 Bacteria 657
142 Ga0501312_075470 3300049528 Bacteria 603
143 Ga0501034_1221342 3300049571 Bacteria 630
144 Ga0501242_017161 3300049674 Bacteria 911
145 nmdc:mga06r32_11774_c1 3300050510 Bacteria 7878
146 nmdc:mga0rr50_1364615_c1 3300050513 Unclassified 600
147 nmdc:mga0rr50_278367_c1 3300050513 Bacteria 1396
148 nmdc:mga08x19_13521_c1 3300050514 Bacteria 4936
149 nmdc:mga08x19_177972_c1 3300050514 Bacteria 1451
150 2718715952 2718217752 Bacteria 915884
151 JGI25406J46586_10000023
152 rootH2_10035970
153 Ga0065715_10456584
154 Ga0070658_10004141
155 Ga0070658_10177328
156 Ga0070683_100804019
157 Ga0070690_100782805
158 Ga0070660_100535806
159 Ga0070689_100368908
160 Ga0070689_101303509
161 Ga0070688_101046523
162 Ga0070709_11146300
163 Ga0070714_100606816
164 Ga0070713_100260330
165 Ga0070710_10318471
166 Ga0070710_10436918
167 Ga0070711_100001234
168 Ga0070711_100049776
169 Ga0070711_100533072
170 Ga0070694_100030238
171 Ga0070708_100088524
172 Ga0070708_100471432
173 Ga0070708_101248022
174 Ga0070706_100027802
175 Ga0070706_100052304
176 Ga0070706_100810170
177 Ga0070707_100000846
178 Ga0070707_100026640
179 Ga0070707_100140239
180 Ga0070707_100612290
181 Ga0070707_100618391
182 Ga0070707_100865841
183 Ga0070698_100021766
184 Ga0070698_100049114
185 Ga0070699_100283757
186 Ga0070699_100714251
187 Ga0070699_101394994
188 Ga0070679_100157251
189 Ga0070679_100317348
190 Ga0070679_100925009
191 Ga0070679_101561915
192 Ga0070697_100792013
193 Ga0070697_101411167
194 Ga0070686_100000946
195 Ga0070695_100791656
196 Ga0070693_100204889
197 Ga0068858_100276572
198 Ga0068860_100514741
199 Ga0068862_101521294
200 Ga0081539_10000014
201 Ga0081539_10022679
202 Ga0070717_10001871
203 Ga0070717_10604710
204 Ga0070716_100282550
205 Ga0070712_100343813
206 Ga0075431_100894800
207 Ga0075436_100193531
208 Ga0075436_101002204
209 Ga0075435_100004588
210 Ga0075435_100468544
211 Ga0105240_10620025
212 Ga0111539_10888453
213 Ga0105243_10004235
214 Ga0105237_10035955
215 Ga0105237_10356380
216 Ga0105239_11178392
217 Ga0105246_11148749
218 Ga0157369_10442105
219 Ga0157374_11136305
220 Ga0157372_10277768
221 Ga0157375_12456241
222 Ga0206349_1369860
223 Ga0206353_11998563
224 Ga0224712_10379587
225 Ga0207692_10320996
226 Ga0207692_10359051
227 Ga0207705_10087407
228 Ga0207684_10011334
229 Ga0207684_10044335
230 Ga0207684_10097402
231 Ga0207684_10231219
232 Ga0207707_10178311
233 Ga0207671_10032757
234 Ga0207671_10139047
235 Ga0207693_10837665
236 Ga0207663_10051606
237 Ga0207663_10504166
238 Ga0207652_11585769
239 Ga0207646_10000386
240 Ga0207646_10000411
241 Ga0207646_10042168
242 Ga0207709_10002581
243 Ga0207665_10170335
244 Ga0207661_10843297
245 Ga0207703_10062119
246 Ga0207641_10756207
247 Ga0207676_10968307
248 Ga0268264_10624700
249 Ga0265337_1000183
250 Ga0265326_10142153
251 Ga0265319_1000016
252 Ga0265318_10110169
253 Ga0265336_10016060
254 Ga0265338_10001031
255 Ga0265338_10001186
256 Ga0265338_10061282
257 Ga0265338_10108920
258 Ga0265338_10279034
259 Ga0265338_10295491
260 Ga0265320_10005101
261 Ga0265320_10132634
262 Ga0265340_10014264
263 Ga0265327_10059420
264 Ga0265316_10014882
265 Ga0265316_10049575
266 Ga0265316_10395360
267 Ga0265313_10003086
268 Ga0373936_0350672
269 Ga0373936_0377159
270 Ga0373943_0042688
271 Ga0316574_0710498
272 Ga0373937_1712212
273 Ga0451800_0342998
274 Ga0451577_0033809
275 Ga0451577_0162465
276 Ga0453684_0212462
277 Ga0451576_0577147
278 Ga0451576_1436318
279 Ga0495608_0186104
280 Ga0495586_0185856
281 Ga0495645_0132853
282 Ga0495634_0103197
283 Ga0495599_0486718
284 Ga0495658_0794198
285 Ga0495680_0162123
286 Ga0495675_0229365
287 Ga0501305_010333
288 Ga0501305_059459
289 Ga0501305_081099
290 Ga0501307_028262
291 Ga0501312_060063
292 Ga0501312_075470
293 Ga0501034_1221342
294 Ga0501242_017161
295 nmdc:mga06r32_11774_c1
296 nmdc:mga0rr50_1364615_c1
297 nmdc:mga0rr50_278367_c1
298 nmdc:mga08x19_13521_c1
299 nmdc:mga08x19_177972_c1
300 2718715952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

5

141

0.95

PF08534

Redoxin

Redoxin

4

160

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9332 3 163
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9222 4 163
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.905 3 163
1y25-assembly1.cif.gz_B structure of mycobacterial thiol peroxidase tpx 0.9009 4 160
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9004 1 164
ID Description Score Start End Superfamily
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9253 4 163 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.897 1 163 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8838 7 163 3.40.30.10
4g2eA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8807 3 164 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8773 3 164 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A800JG21-F1-model_v4 Redoxin domain-containing protein 0.9868 3 163 GO:0016209
GO:0016491
AF-A0A2V5KDL7-F1-model_v4 Thioredoxin domain-containing protein 0.9857 1 132 GO:0016209
GO:0016491
AF-A0A1G3ZKR4-F1-model_v4 Thioredoxin domain-containing protein 0.9842 3 164 GO:0016209
GO:0016491
AF-A0A3S5IXT7-F1-model_v4 Peroxiredoxin 0.9785 1 160 GO:0016209
GO:0016491
AF-A0A2V5KDL7-F1-model_v4 Thioredoxin domain-containing protein 0.9784 1 132 GO:0016209
GO:0016491

Map