F207292

General Info

Members Datasets Scaffolds Average Seq Length
149 113 298 332

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_366989_c1|nmdc:mga06r32_366989_c1_127_1215
Length 362
Sequence MGVVHGSDYLERNFRRFMRPTRRRVNCMKAFVVAQYGKGGLRAAHVPEPAVGPRDVLVRVCAAGVNPLDKMIRDGEFKLLLKYKTPFVLGHDVAGIVTRVGDDVRDYKIGDEVYSRPRDLRIGAFAEYIAIDQADVAPKPRSLTMQQAAALPLVALAAWQALVEVAGVKPGQKVLVHAGAGGLGSTVVQLARHLGAYVATTARGTDEEKVRALGAEEVIDYTKADFAELLTGYDVVLDSLGGDNLARSLTVLKPGGLALSVVGPPDAAFAEQIGQPMLKPVMWLMSRRVRARARRLGVRYAFFFMWADGARLKTLASLYDAGALRPVLDRTFPFDDTIEAMAYVEQGRAKGKIVVTMPAGGG

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
66 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
67 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
74 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
95 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
96 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
97 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
98 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
99 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 2558860280 Kutzneria sp. 744 Isolate Unclassified
103 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
104 2643221576 Nocardioides sp. Root614 Isolate Unclassified
105 2643221590 Nocardioides sp. Root682 Isolate Unclassified
106 2643221617 Nocardioides sp. Root79 Isolate Unclassified
107 2643221620 Nocardioides sp. Root240 Isolate Unclassified
108 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
109 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
110 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
111 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
112 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
113 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.95
Metatranscriptomes 0
Isolates 8.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 0
Rhizoplane 6.04
Rhizosphere 82.55
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_366989_c1 3300050510 Bacteria 1423
2 Ga0065714_10065909 3300005288 Bacteria 8123
3 Ga0065714_10069494 3300005288 Bacteria 4206
4 Ga0065714_10090865 3300005288 Bacteria 1910
5 Ga0065707_10087449 3300005295 Bacteria 5019
6 Ga0070676_10081038 3300005328 Bacteria 1969
7 Ga0070660_100039034 3300005339 Bacteria 3607
8 Ga0070668_100000187 3300005347 Bacteria 40452
9 Ga0070667_100053003 3300005367 Bacteria 3423
10 Ga0070714_100013868 3300005435 Bacteria 6463
11 Ga0070714_100133884 3300005435 Bacteria 2217
12 Ga0070711_100074571 3300005439 Bacteria 2400
13 Ga0070662_100182272 3300005457 Bacteria 1656
14 Ga0070681_10241269 3300005458 Bacteria 1721
15 Ga0070706_100026336 3300005467 Bacteria 5351
16 Ga0070706_100033725 3300005467 Bacteria 4726
17 Ga0070707_100154123 3300005468 Bacteria 2238
18 Ga0070707_100262340 3300005468 Bacteria 1680
19 Ga0070698_100029453 3300005471 Bacteria 5700
20 Ga0070697_100002942 3300005536 Bacteria 13110
21 Ga0070697_100059870 3300005536 Bacteria 3103
22 Ga0070697_100324756 3300005536 Bacteria 1326
23 Ga0068860_100000631 3300005843 Bacteria 41527
24 Ga0075365_10098673 3300006038 Bacteria 1998
25 Ga0070712_100002689 3300006175 Bacteria 10968
26 Ga0075367_10014967 3300006178 Bacteria 4205
27 Ga0075428_100009813 3300006844 Bacteria 10642
28 Ga0075428_100217894 3300006844 Bacteria 2061
29 Ga0075430_100018060 3300006846 Bacteria 6004
30 Ga0075431_100002036 3300006847 Bacteria 19299
31 Ga0075431_100004003 3300006847 Bacteria 14364
32 Ga0075431_100018155 3300006847 Bacteria 7157
33 Ga0075434_100085263 3300006871 Bacteria 3158
34 Ga0075429_100007823 3300006880 Bacteria 9285
35 Ga0075429_100030420 3300006880 Bacteria 4691
36 Ga0075429_100255643 3300006880 Bacteria 1534
37 Ga0075436_100000382 3300006914 Bacteria 28324
38 Ga0075436_100137283 3300006914 Bacteria 1717
39 Ga0075435_100109152 3300007076 Bacteria 2300
40 Ga0105244_10000002 3300009036 Bacteria 495554
41 Ga0111539_10043186 3300009094 Bacteria 5405
42 Ga0114129_10010225 3300009147 Bacteria 13384
43 Ga0114129_10529371 3300009147 Bacteria 1535
44 Ga0105242_10107807 3300009176 Bacteria 2370
45 Ga0105237_10061554 3300009545 Bacteria 3753
46 Ga0105237_10294726 3300009545 Bacteria 1625
47 Ga0105246_10305242 3300011119 Bacteria 1287
48 Ga0157370_10001226 3300013104 Bacteria 32114
49 Ga0157374_10118329 3300013296 Bacteria 2555
50 Ga0163162_10245137 3300013306 Bacteria 1923
51 Ga0163162_10246905 3300013306 Bacteria 1916
52 Ga0157372_10070950 3300013307 Bacteria 3921
53 Ga0157375_10263681 3300013308 Unclassified 1884
54 Ga0182008_10003085 3300014497 Bacteria 10225
55 Ga0157377_10066994 3300014745 Bacteria 2066
56 Ga0207684_10000773 3300025910 Bacteria 37123
57 Ga0207684_10055616 3300025910 Bacteria 3357
58 Ga0207657_10069283 3300025919 Bacteria 2994
59 Ga0207646_10167058 3300025922 Bacteria 1987
60 Ga0207700_10530346 3300025928 Bacteria 1044
61 Ga0207664_10042125 3300025929 Bacteria 3562
62 Ga0207664_10127651 3300025929 Bacteria 2137
63 Ga0207690_10051153 3300025932 Bacteria 2762
64 Ga0207706_10251738 3300025933 Bacteria 1543
65 Ga0207689_10130654 3300025942 Bacteria 2067
66 Ga0207668_10003710 3300025972 Bacteria 8986
67 Ga0207668_10205541 3300025972 Bacteria 1571
68 Ga0207658_10023985 3300025986 Bacteria 4263
69 Ga0207658_10181826 3300025986 Bacteria 1741
70 Ga0207703_10362400 3300026035 Bacteria 1337
71 Ga0207702_10349891 3300026078 Bacteria 1414
72 Ga0207676_10394589 3300026095 Bacteria 1292
73 Ga0268264_10001893 3300028381 Bacteria 18990
74 Ga0307511_10090679 3300030521 Bacteria 2074
75 Ga0307408_100013996 3300031548 Bacteria 5328
76 Ga0307408_100064726 3300031548 Bacteria 2679
77 Ga0307516_10034779 3300031730 Bacteria 5059
78 Ga0307405_10046685 3300031731 Bacteria 2663
79 Ga0307413_10000192 3300031824 Bacteria 17650
80 Ga0307406_10082825 3300031901 Bacteria 2138
81 Ga0307407_10078214 3300031903 Bacteria 1992
82 Ga0307412_10006928 3300031911 Bacteria 6430
83 Ga0373942_0006772 3300035207 Bacteria 2647
84 Ga0395898_0027172 3300037466 Bacteria 5748
85 Ga0395898_0051462 3300037466 Bacteria 4027
86 Ga0395901_0017353 3300038443 Bacteria 7348
87 Ga0395901_0070527 3300038443 Bacteria 3641
88 Ga0395901_0114167 3300038443 Bacteria 2837
89 Ga0395901_0202438 3300038443 Bacteria 2081
90 Ga0395901_0516792 3300038443 Bacteria 1214
91 Ga0439461_0016116 3300041410 Bacteria 1439
92 Ga0439466_0001709 3300041411 Bacteria 8566
93 Ga0439466_0008474 3300041411 Bacteria 3875
94 Ga0439431_0000657 3300041997 Bacteria 7369
95 Ga0439458_0009615 3300042157 Bacteria 2153
96 Ga0439434_0019708 3300042435 Bacteria 2023
97 Ga0495628_0061727 3300046516 Bacteria 2939
98 Ga0495637_0058625 3300046520 Bacteria 1587
99 Ga0495668_0050102 3300046616 Bacteria 2314
100 Ga0495657_0033603 3300046675 Bacteria 3570
101 Ga0495669_0004479 3300046684 Bacteria 5772
102 Ga0495613_0000956 3300046689 Bacteria 22069
103 Ga0495613_0031546 3300046689 Bacteria 3936
104 Ga0495680_0023145 3300047322 Bacteria 5169
105 Ga0495680_0275405 3300047322 Bacteria 1187
106 Ga0496100_0155482 3300048903 Bacteria 1635
107 Ga0496102_0245553 3300048905 Bacteria 1688
108 Ga0496108_0080874 3300048911 Bacteria 2753
109 Ga0496109_0149796 3300048912 Bacteria 2184
110 Ga0496110_0334806 3300048913 Bacteria 1379
111 Ga0496110_0352613 3300048913 Bacteria 1340
112 Ga0496113_0096292 3300048916 Bacteria 2288
113 Ga0496114_0139509 3300048917 Bacteria 2098
114 Ga0496114_0196296 3300048917 Bacteria 1767
115 Ga0501039_0065641 3300049575 Bacteria 2816
116 Ga0501068_0004231 3300049584 Bacteria 7784
117 Ga0501070_0110667 3300049586 Bacteria 2270
118 Ga0501073_0004182 3300049589 Bacteria 10828
119 Ga0501074_0094369 3300049590 Bacteria 2143
120 Ga0501080_0003598 3300049742 Bacteria 13645
121 nmdc:mga05p37_31708_c1 3300050507 Bacteria 6458
122 nmdc:mga09592_16038_c1 3300050508 Bacteria 6125
123 nmdc:mga0qj67_14700_c1 3300050509 Bacteria 5918
124 nmdc:mga06r32_124319_c1 3300050510 Bacteria 2547
125 nmdc:mga06r32_34324_c1 3300050510 Bacteria 4783
126 nmdc:mga06r32_4460_c1 3300050510 Bacteria 12535
127 nmdc:mga0n895_24062_c1 3300050512 Bacteria 5734
128 nmdc:mga0n895_472748_c1 3300050512 Bacteria 1264
129 nmdc:mga08x19_146383_c1 3300050514 Bacteria 1598
130 nmdc:mga08x19_65_c1 3300050514 Bacteria 109380
131 Ga0495601_0058974 3300053077 Bacteria 2433
132 Ga0495619_0073136 3300053085 Bacteria 2297
133 Ga0500644_0036659 3300053088 Bacteria 1597
134 Ga0500646_0010521 3300053090 Bacteria 2373
135 Ga0500628_000179 3300053129 Bacteria 12203
136 Ga0500616_0002860 3300053153 Bacteria 13852
137 Ga0501082_0037297 3300060353 Bacteria 4189
138 2559426610 2558860280 Bacteria 11429938
139 2585309474 2582581313 Bacteria 10042643
140 2643889511 2643221576 Bacteria 5214352
141 2643958567 2643221590 Bacteria 5214697
142 2644102149 2643221617 Bacteria 5139111
143 2644115372 2643221620 Bacteria 5134593
144 2644373530 2643221667 Bacteria 5627472
145 2740001684 2739367857 Bacteria 5433684
146 2740006500 2739367858 Bacteria 5432813
147 2753272493 2751185782 Bacteria 11227053
148 2852643378 2852635781 Bacteria 8251373
149 2902815895 2902810491 Bacteria 6794147
150 nmdc:mga06r32_366989_c1
151 Ga0065714_10065909
152 Ga0065714_10069494
153 Ga0065714_10090865
154 Ga0065707_10087449
155 Ga0070676_10081038
156 Ga0070660_100039034
157 Ga0070668_100000187
158 Ga0070667_100053003
159 Ga0070714_100013868
160 Ga0070714_100133884
161 Ga0070711_100074571
162 Ga0070662_100182272
163 Ga0070681_10241269
164 Ga0070706_100026336
165 Ga0070706_100033725
166 Ga0070707_100154123
167 Ga0070707_100262340
168 Ga0070698_100029453
169 Ga0070697_100002942
170 Ga0070697_100059870
171 Ga0070697_100324756
172 Ga0068860_100000631
173 Ga0075365_10098673
174 Ga0070712_100002689
175 Ga0075367_10014967
176 Ga0075428_100009813
177 Ga0075428_100217894
178 Ga0075430_100018060
179 Ga0075431_100002036
180 Ga0075431_100004003
181 Ga0075431_100018155
182 Ga0075434_100085263
183 Ga0075429_100007823
184 Ga0075429_100030420
185 Ga0075429_100255643
186 Ga0075436_100000382
187 Ga0075436_100137283
188 Ga0075435_100109152
189 Ga0105244_10000002
190 Ga0111539_10043186
191 Ga0114129_10010225
192 Ga0114129_10529371
193 Ga0105242_10107807
194 Ga0105237_10061554
195 Ga0105237_10294726
196 Ga0105246_10305242
197 Ga0157370_10001226
198 Ga0157374_10118329
199 Ga0163162_10245137
200 Ga0163162_10246905
201 Ga0157372_10070950
202 Ga0157375_10263681
203 Ga0182008_10003085
204 Ga0157377_10066994
205 Ga0207684_10000773
206 Ga0207684_10055616
207 Ga0207657_10069283
208 Ga0207646_10167058
209 Ga0207700_10530346
210 Ga0207664_10042125
211 Ga0207664_10127651
212 Ga0207690_10051153
213 Ga0207706_10251738
214 Ga0207689_10130654
215 Ga0207668_10003710
216 Ga0207668_10205541
217 Ga0207658_10023985
218 Ga0207658_10181826
219 Ga0207703_10362400
220 Ga0207702_10349891
221 Ga0207676_10394589
222 Ga0268264_10001893
223 Ga0307511_10090679
224 Ga0307408_100013996
225 Ga0307408_100064726
226 Ga0307516_10034779
227 Ga0307405_10046685
228 Ga0307413_10000192
229 Ga0307406_10082825
230 Ga0307407_10078214
231 Ga0307412_10006928
232 Ga0373942_0006772
233 Ga0395898_0027172
234 Ga0395898_0051462
235 Ga0395901_0017353
236 Ga0395901_0070527
237 Ga0395901_0114167
238 Ga0395901_0202438
239 Ga0395901_0516792
240 Ga0439461_0016116
241 Ga0439466_0001709
242 Ga0439466_0008474
243 Ga0439431_0000657
244 Ga0439458_0009615
245 Ga0439434_0019708
246 Ga0495628_0061727
247 Ga0495637_0058625
248 Ga0495668_0050102
249 Ga0495657_0033603
250 Ga0495669_0004479
251 Ga0495613_0000956
252 Ga0495613_0031546
253 Ga0495680_0023145
254 Ga0495680_0275405
255 Ga0496100_0155482
256 Ga0496102_0245553
257 Ga0496108_0080874
258 Ga0496109_0149796
259 Ga0496110_0334806
260 Ga0496110_0352613
261 Ga0496113_0096292
262 Ga0496114_0139509
263 Ga0496114_0196296
264 Ga0501039_0065641
265 Ga0501068_0004231
266 Ga0501070_0110667
267 Ga0501073_0004182
268 Ga0501074_0094369
269 Ga0501080_0003598
270 nmdc:mga05p37_31708_c1
271 nmdc:mga09592_16038_c1
272 nmdc:mga0qj67_14700_c1
273 nmdc:mga06r32_124319_c1
274 nmdc:mga06r32_34324_c1
275 nmdc:mga06r32_4460_c1
276 nmdc:mga0n895_24062_c1
277 nmdc:mga0n895_472748_c1
278 nmdc:mga08x19_146383_c1
279 nmdc:mga08x19_65_c1
280 Ga0495601_0058974
281 Ga0495619_0073136
282 Ga0500644_0036659
283 Ga0500646_0010521
284 Ga0500628_000179
285 Ga0500616_0002860
286 Ga0501082_0037297
287 2559426610
288 2585309474
289 2643889511
290 2643958567
291 2644102149
292 2644115372
293 2644373530
294 2740001684
295 2740006500
296 2753272493
297 2852643378
298 2902815895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

213

355

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

52

141

0.89

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

182

300

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.916 2 331
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9139 1 333
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9056 1 333
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9016 1 332
5a4d-assembly5.cif.gz_E crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp 0.8964 1 332
ID Description Score Start End Superfamily
af_A0A1D6J5A6_4_169_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9617 15 123 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9594 14 136 3.90.180.10
af_Q54II4_2_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9564 2 123 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9501 2 132 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9496 16 114 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3CSH0-F1-model_v4 NADP-dependent oxidoreductase 1.001 1 111
AF-A0A2V7NA27-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9964 1 333 GO:0008270
GO:0016491
AF-A0A2V7NA27-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9934 1 333 GO:0008270
GO:0016491
AF-A0A4Q3CSH0-F1-model_v4 NADP-dependent oxidoreductase 0.9919 1 111
AF-A0A660DZE7-F1-model_v4 NADPH:quinone reductase [Lactobacillus koreensis] 0.9908 1 333 GO:0008270
GO:0016491

Map