F207060

General Info

Members Datasets Scaffolds Average Seq Length
149 124 298 769

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0013751|Ga0496108_0013751_3035_5536
Length 823
Sequence VHKNLRTPLVLLAAGGLVLGGVGVSSIAVAAPDGGHRTPAKATAQSTVHDLPDPKEDKRRALREEAISQVLRGQAEVENRNGSKVVRLSGGVAPKRVSKGRAAAAAPQAKDQYVELQRERTDKIFVVLAEFGNERHPSYPDQDTDPNTAGPTTFDGPLHNAIPAPDRSVDNSTVWQADYSPDHYRQLYFGSGAGVQSLKTYYQKQSSGRYSVAGEVTDWVKVRYNEARYGRSNGYPCSGNICSNSYQLIRDAVDQWVANRKAAGATDASIKAELSSFDSWDRYDYDGDGNFNEPDGYIDHFQIVHAGGDQADGDPYQGEDAIWSHRSKAFAGTGQGPAGNPDGGTQIGNTGLWVADYTMQPENGGLSVFAHEYGHDLGLPDLYDTAASGDNPVNWWSLMAQSRVSAKKDVGIGTRPQDLGAWDKMQLGWLDYEVVPQGVRRTLNLGPHEYNSSSAQAVVTPIAQRPVVTDYPDPPQGAKTWWSGSGDDYSATMSRSLTLPAGTTTLTFQTAYNIEDCEADPCDYAFVEVKVGGAWVALPGSITDPEEGNGIDGLSNGWVPATFDLSAYAGQTVQLRVRYETDGAAQGQDPAAPSGIFVDDLAVTSNGSVIFSDGAESGANGWELQGFRAVGTSVTTMYDRFYIASNREYVSYDKYLKTGPYNFGFPDRPDVVEHFPYQDGLLVSLWDTSQTNNNTSQHPGEGQILPIDSHPDVIYRLDGKPWRGRIQTYDAPFSLQKGDSFTLHAQETGQASYIRGQAAQPLFDDTRNYWRDALPRVGVKTPGVGVTMKVVRENETSVRVQVGVTTPRPDAAVRNAAADVRTR

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
5 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
9 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
10 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
22 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
23 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
24 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
25 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
26 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
27 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
28 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
29 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
30 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
31 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
32 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
33 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
34 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
35 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
36 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
37 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
38 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
39 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
40 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
41 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
42 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
43 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
44 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
45 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
46 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
47 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
48 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
49 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
50 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
51 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
52 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
53 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
54 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
55 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
56 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
57 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
72 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
89 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
90 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
91 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
92 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
93 2643221548 Streptomyces sp. Root55 Isolate Unclassified
94 2643221578 Streptomyces sp. Root63 Isolate Unclassified
95 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
96 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
97 2643221711 Terrabacter sp. Root85 Isolate Unclassified
98 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
99 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
100 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
101 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
102 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
103 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
104 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
105 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
106 2867475112 Streptomyces sp. TM32 Isolate Unclassified
107 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
108 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
109 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
110 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
111 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
112 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
113 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
114 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
115 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
116 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
117 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
118 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
119 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
120 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
121 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
122 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
123 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
124 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.17
Metatranscriptomes 0
Isolates 24.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 6.04
Rhizosphere 77.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0013751 3300048911 Bacteria 6602
2 JGI24740J21852_10010498 3300001979 Bacteria 3560
3 Ga0070683_100001284 3300005329 Bacteria 19115
4 Ga0070684_100001673 3300005535 Bacteria 16113
5 Ga0081538_10003189 3300005981 Bacteria 15573
6 Ga0081539_10000264 3300005985 Bacteria 120533
7 Ga0075367_10019801 3300006178 Bacteria 3736
8 Ga0075428_100015411 3300006844 Bacteria 8475
9 Ga0075431_100062579 3300006847 Bacteria 3839
10 Ga0105245_10009945 3300009098 Bacteria 8283
11 Ga0114129_10011289 3300009147 Bacteria 12731
12 Ga0163162_10063873 3300013306 Bacteria 3726
13 Ga0157372_10016037 3300013307 Bacteria 8037
14 Ga0182007_10000422 3300015262 Bacteria 25872
15 Ga0183367_1006 3300015688 Bacteria 648044
16 Ga0207426_1001387 3300025302 Bacteria 20464
17 Ga0207687_10052600 3300025927 Bacteria 2843
18 Ga0207661_10006316 3300025944 Bacteria 8385
19 Ga0307512_10003613 3300030522 Bacteria 17685
20 Ga0307512_10014830 3300030522 Bacteria 7250
21 Ga0307513_10038277 3300031456 Bacteria 5326
22 Ga0326468_10000303 3300031889 Bacteria 5222
23 Ga0307507_10008263 3300033179 Bacteria 14519
24 Ga0395899_0011010 3300037312 Bacteria 6928
25 Ga0466965_0008386 3300044683 Bacteria 4780
26 Ga0466960_0006474 3300044901 Bacteria 4698
27 Ga0466960_0012464 3300044901 Bacteria 3589
28 Ga0466967_0060461 3300045976 Bacteria 3357
29 Ga0495617_012220 3300046452 Bacteria 2924
30 Ga0495592_0010408 3300046454 Bacteria 7017
31 Ga0495629_0019960 3300046459 Bacteria 4782
32 Ga0495629_0029253 3300046459 Bacteria 3908
33 Ga0495653_0009931 3300046463 Bacteria 7787
34 Ga0495583_0025880 3300046506 Bacteria 2921
35 Ga0495628_0026327 3300046516 Bacteria 4744
36 Ga0495643_0003993 3300046522 Bacteria 10544
37 Ga0495640_0004464 3300046533 Bacteria 11155
38 Ga0495640_0054581 3300046533 Bacteria 2736
39 Ga0495633_0012863 3300046558 Bacteria 4430
40 Ga0495667_0044424 3300046559 Bacteria 2943
41 Ga0495634_0014997 3300046642 Bacteria 5572
42 Ga0495657_0015537 3300046675 Bacteria 5568
43 Ga0495613_0015831 3300046689 Bacteria 5613
44 Ga0495589_0034668 3300046794 Bacteria 2532
45 Ga0495600_0008971 3300046809 Bacteria 6161
46 Ga0495604_0009328 3300047317 Bacteria 7767
47 Ga0495636_0007775 3300047318 Bacteria 4218
48 Ga0495674_0055739 3300047319 Bacteria 3465
49 Ga0495676_0008200 3300047321 Bacteria 9583
50 Ga0495687_000864 3300047443 Bacteria 32105
51 Ga0495675_0003793 3300047444 Bacteria 9143
52 Ga0495681_0024820 3300047470 Bacteria 3146
53 Ga0495602_0089351 3300048088 Bacteria 2562
54 Ga0496101_0009042 3300048904 Bacteria 6534
55 Ga0496102_0010074 3300048905 Bacteria 8132
56 Ga0496103_0009576 3300048906 Bacteria 5733
57 Ga0496104_0016991 3300048907 Bacteria 6619
58 Ga0496109_0023232 3300048912 Bacteria 5501
59 Ga0496110_0018886 3300048913 Bacteria 5792
60 Ga0496114_0034886 3300048917 Bacteria 4153
61 Ga0501031_0000698 3300049568 Bacteria 20013
62 Ga0501031_0029074 3300049568 Bacteria 3604
63 Ga0501032_0001743 3300049569 Bacteria 17198
64 Ga0501032_0013697 3300049569 Bacteria 5760
65 Ga0501033_0029218 3300049570 Bacteria 4142
66 Ga0501034_0003737 3300049571 Bacteria 17198
67 Ga0501034_0047146 3300049571 Bacteria 4353
68 Ga0501036_0001675 3300049572 Bacteria 17187
69 Ga0501036_0011018 3300049572 Bacteria 7478
70 Ga0501036_0011678 3300049572 Bacteria 7279
71 Ga0501036_0032588 3300049572 Bacteria 4404
72 Ga0501037_0002548 3300049573 Bacteria 13174
73 Ga0501038_0001931 3300049574 Bacteria 19126
74 Ga0501038_0002585 3300049574 Bacteria 16895
75 Ga0501038_0025351 3300049574 Bacteria 5287
76 Ga0501039_0013697 3300049575 Bacteria 6201
77 Ga0501040_0006164 3300049576 Bacteria 7778
78 Ga0501041_0002122 3300049577 Bacteria 11174
79 Ga0501042_0011267 3300049578 Bacteria 6028
80 Ga0501042_0015817 3300049578 Bacteria 5170
81 Ga0501043_0002049 3300049579 Bacteria 17200
82 Ga0501043_0028218 3300049579 Bacteria 4405
83 Ga0501047_0013875 3300049581 Bacteria 7652
84 Ga0501047_0027728 3300049581 Bacteria 5458
85 Ga0501048_0014777 3300049582 Bacteria 5775
86 Ga0501067_0000438 3300049583 Bacteria 22797
87 Ga0501068_0002592 3300049584 Bacteria 9584
88 Ga0501068_0007450 3300049584 Bacteria 6062
89 Ga0501071_0000744 3300049587 Bacteria 17215
90 Ga0501071_0009245 3300049587 Bacteria 6555
91 Ga0501071_0032201 3300049587 Bacteria 3722
92 Ga0501071_0056901 3300049587 Bacteria 2825
93 Ga0501072_0006910 3300049588 Bacteria 8613
94 Ga0501072_0038653 3300049588 Bacteria 3745
95 Ga0501074_0001014 3300049590 Bacteria 18264
96 Ga0501075_0032617 3300049591 Bacteria 3870
97 Ga0501076_0006687 3300049592 Bacteria 8366
98 Ga0501076_0039176 3300049592 Bacteria 3721
99 Ga0501077_0012977 3300049593 Bacteria 5219
100 Ga0501079_0001208 3300049741 Bacteria 18091
101 Ga0501080_0009744 3300049742 Bacteria 8773
102 Ga0501035_0074506 3300049822 Bacteria 3003
103 Ga0501044_0003698 3300049823 Bacteria 17198
104 Ga0501045_0027827 3300049824 Bacteria 4076
105 nmdc:mga06z11_4807_c1 3300050494 Bacteria 5344
106 nmdc:mga05p37_60825_c1 3300050507 Bacteria 4650
107 nmdc:mga09592_10585_c1 3300050508 Bacteria 7508
108 Ga0500616_0000322 3300053153 Bacteria 68577
109 Ga0500616_0007205 3300053153 Bacteria 7110
110 Ga0501084_0012580 3300054114 Bacteria 7011
111 Ga0530510_0004306 3300061734 Bacteria 9849
112 Ga0530510_0006849 3300061734 Bacteria 7942
113 2585299044 2582581312 Bacteria 7308206
114 2586061224 2585427649 Bacteria 9053857
115 2616900396 2616644941 Bacteria 8510691
116 2643765437 2643221548 Bacteria 8053412
117 2643898222 2643221578 Bacteria 9213798
118 2644409367 2643221673 Bacteria 9196637
119 2644462492 2643221682 Bacteria 6743283
120 2644607689 2643221711 Bacteria 4865335
121 2791916602 2791354901 Bacteria 8322202
122 2793984745 2791355406 Bacteria 11364898
123 2808920150 2808606375 Bacteria 9466072
124 2811846129 2808606982 Bacteria 7791042
125 2811848560 2808606982 Bacteria 7791042
126 2816422080 2816332119 Bacteria 8120218
127 2816428118 2816332119 Bacteria 8120218
128 2819426148 2818991318 Bacteria 5266538
129 2819693365 2818991463 Bacteria 7948711
130 2862291628 2862290372 Bacteria 7471434
131 2867477283 2867475112 Bacteria 6909112
132 2875394111 2875391855 Bacteria 7600475
133 2912760226 2912757875 Bacteria 7940295
134 2946050503 2946045630 Bacteria 8527308
135 2966602972 2966598605 Bacteria 7676064
136 2997456819 2997451912 Bacteria 8492419
137 2997601684 2997600082 Bacteria 9896405
138 3006321642 3006321560 Bacteria 8247479
139 3006486385 3006486233 Bacteria 8157040
140 3006496481 3006493962 Bacteria 8825450
141 8025482421 8025478263 Bacteria 8209203
142 8025533134 8025530807 Bacteria 8495698
143 8047898528 8047893842 Bacteria 11723082
144 8048132753 8048127548 Bacteria 11053136
145 8048360382 8048356638 Bacteria 11044339
146 8048375490 8048369669 Bacteria 11666822
147 8048382715 8048379754 Bacteria 11877923
148 8054161065 8054160619 Bacteria 7783213
149 8056668049 8056667051 Bacteria 6953971
150 Ga0496108_0013751
151 JGI24740J21852_10010498
152 Ga0070683_100001284
153 Ga0070684_100001673
154 Ga0081538_10003189
155 Ga0081539_10000264
156 Ga0075367_10019801
157 Ga0075428_100015411
158 Ga0075431_100062579
159 Ga0105245_10009945
160 Ga0114129_10011289
161 Ga0163162_10063873
162 Ga0157372_10016037
163 Ga0182007_10000422
164 Ga0183367_1006
165 Ga0207426_1001387
166 Ga0207687_10052600
167 Ga0207661_10006316
168 Ga0307512_10003613
169 Ga0307512_10014830
170 Ga0307513_10038277
171 Ga0326468_10000303
172 Ga0307507_10008263
173 Ga0395899_0011010
174 Ga0466965_0008386
175 Ga0466960_0006474
176 Ga0466960_0012464
177 Ga0466967_0060461
178 Ga0495617_012220
179 Ga0495592_0010408
180 Ga0495629_0019960
181 Ga0495629_0029253
182 Ga0495653_0009931
183 Ga0495583_0025880
184 Ga0495628_0026327
185 Ga0495643_0003993
186 Ga0495640_0004464
187 Ga0495640_0054581
188 Ga0495633_0012863
189 Ga0495667_0044424
190 Ga0495634_0014997
191 Ga0495657_0015537
192 Ga0495613_0015831
193 Ga0495589_0034668
194 Ga0495600_0008971
195 Ga0495604_0009328
196 Ga0495636_0007775
197 Ga0495674_0055739
198 Ga0495676_0008200
199 Ga0495687_000864
200 Ga0495675_0003793
201 Ga0495681_0024820
202 Ga0495602_0089351
203 Ga0496101_0009042
204 Ga0496102_0010074
205 Ga0496103_0009576
206 Ga0496104_0016991
207 Ga0496109_0023232
208 Ga0496110_0018886
209 Ga0496114_0034886
210 Ga0501031_0000698
211 Ga0501031_0029074
212 Ga0501032_0001743
213 Ga0501032_0013697
214 Ga0501033_0029218
215 Ga0501034_0003737
216 Ga0501034_0047146
217 Ga0501036_0001675
218 Ga0501036_0011018
219 Ga0501036_0011678
220 Ga0501036_0032588
221 Ga0501037_0002548
222 Ga0501038_0001931
223 Ga0501038_0002585
224 Ga0501038_0025351
225 Ga0501039_0013697
226 Ga0501040_0006164
227 Ga0501041_0002122
228 Ga0501042_0011267
229 Ga0501042_0015817
230 Ga0501043_0002049
231 Ga0501043_0028218
232 Ga0501047_0013875
233 Ga0501047_0027728
234 Ga0501048_0014777
235 Ga0501067_0000438
236 Ga0501068_0002592
237 Ga0501068_0007450
238 Ga0501071_0000744
239 Ga0501071_0009245
240 Ga0501071_0032201
241 Ga0501071_0056901
242 Ga0501072_0006910
243 Ga0501072_0038653
244 Ga0501074_0001014
245 Ga0501075_0032617
246 Ga0501076_0006687
247 Ga0501076_0039176
248 Ga0501077_0012977
249 Ga0501079_0001208
250 Ga0501080_0009744
251 Ga0501035_0074506
252 Ga0501044_0003698
253 Ga0501045_0027827
254 nmdc:mga06z11_4807_c1
255 nmdc:mga05p37_60825_c1
256 nmdc:mga09592_10585_c1
257 Ga0500616_0000322
258 Ga0500616_0007205
259 Ga0501084_0012580
260 Ga0530510_0004306
261 Ga0530510_0006849
262 2585299044
263 2586061224
264 2616900396
265 2643765437
266 2643898222
267 2644409367
268 2644462492
269 2644607689
270 2791916602
271 2793984745
272 2808920150
273 2811846129
274 2811848560
275 2816422080
276 2816428118
277 2819426148
278 2819693365
279 2862291628
280 2867477283
281 2875394111
282 2912760226
283 2946050503
284 2966602972
285 2997456819
286 2997601684
287 3006321642
288 3006486385
289 3006496481
290 8025482421
291 8025533134
292 8047898528
293 8048132753
294 8048360382
295 8048375490
296 8048382715
297 8054161065
298 8056668049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20774

InhA-like_VEG

Immune inhibitor A-like metallopeptidase, VEG domain

635

802

0.94

PF05547

Peptidase_M6

Immune inhibitor A peptidase M6, catalytic domain

110

430

0.86

PF20773

InhA-like_MAM

Immune inhibitor A-like, MAM domain

441

632

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yu6-assembly1.cif.gz_A crystal structure of bacillus anthracis immune inhibitor a2 peptidase zymogen 0.7603 18 754
4yu5-assembly1.cif.gz_A crystal structure of selenomethionine variant of bacillus anthracis immune inhibitor a2 peptidase zymogen 0.7468 8 754
4yu5-assembly1.cif.gz_A crystal structure of selenomethionine variant of bacillus anthracis immune inhibitor a2 peptidase zymogen 0.7428 8 754
4yu6-assembly2.cif.gz_B crystal structure of bacillus anthracis immune inhibitor a2 peptidase zymogen 0.7395 8 754
4yu6-assembly2.cif.gz_B crystal structure of bacillus anthracis immune inhibitor a2 peptidase zymogen 0.7366 8 754
ID Description Score Start End Superfamily
af_A0A0G2KB47_380_549_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6591 418 562 2.60.120.200
af_Q9NA93_425_554_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6442 413 550 2.60.120.200
af_A0A1R3LXF8_43_196_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.611 443 553 2.60.120.260
af_Q5RHM1_257_421_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6042 416 553 2.60.120.200
af_Q7Z304_19_166_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.5967 416 555 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A6A7MQ70-F1-model_v4 deleted 0.9884 635 754
AF-A0A6A7MQ70-F1-model_v4 deleted 0.9803 635 754
AF-A0A1C4U0I6-F1-model_v4 Immune inhibitor A peptidase M6 0.9711 657 751
AF-A0A7W2HE30-F1-model_v4 Immune inhibitor A 0.9588 648 754
AF-A0A6B3F7K1-F1-model_v4 Protease 0.9552 569 709 GO:0006508
GO:0008233

Map